Gene Card
Gene overview
cDNA / CDS / Protein Sequences
801 bp · LXL04_023130|LXL04_023130|OH1004|cDNA
ATGAGGAAGAAGCTCGATACGCGTTTCCCGGCCGCTAGAATAAAAAAGATAATGCAAACGGATGAGGATGTTGGGAAGATTGCAATGGCTGTCCCTCTTCTAGTATCTAAAGCTTTGGAACTATTTCTTCAAGACCTTTGTGACAGGACATATGAAATCACTCTTCGAAGGGGAGCAAAGACTTTAAACTCTATGCACTTAAAACAATGCGTCCAGAGCTTTAACGTGTTTGACTTTCTGAGAGATATTGTTGGTAAGGT...
801 bp · LXL04_023130|LXL04_023130|OH1004|CDS
ATGAGGAAGAAGCTCGATACGCGTTTCCCGGCCGCTAGAATAAAAAAGATAATGCAAACGGATGAGGATGTTGGGAAGATTGCAATGGCTGTCCCTCTTCTAGTATCTAAAGCTTTGGAACTATTTCTTCAAGACCTTTGTGACAGGACATATGAAATCACTCTTCGAAGGGGAGCAAAGACTTTAAACTCTATGCACTTAAAACAATGCGTCCAGAGCTTTAACGTGTTTGACTTTCTGAGAGATATTGTTGGTAAGGT...
Protein
Download Protein FASTA266 aa · LXL04_023130|LXL04_023130|OH1004|PROTEIN
MRKKLDTRFPAARIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLRRGAKTLNSMHLKQCVQSFNVFDFLRDIVGKVPDLGGSDAAGDDKSSTKRRKVADDDHNAGDDEDSKRDKSLHSLNSNGGGRGRGRGRGRGRGRISRAEKESNLAASSLDSDSANKQKPILDSIEDSGSKQNHIHISAIGMAEDTVKVRNFDLNLDLDENGDTPAISPPPPLPEPESPGWSLAEMGGIDPVQLANLNSGVGEDEE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023130 |
|---|---|
| TK1151 ID | TkA06G395670 |
| OH-1004 ID | LXL04_023130 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 95.500 |
| Protein coverage (%) | TK1151 99.624 / OH-1004 99.624Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023130 |
|---|---|
| Location | Chr05:24027553-24030258 (-) |
| Description | Similar to DRAP1: Dr1-associated corepressor |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0017055 negative regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0017054 negative cofactor 2 complex Cellular Component GO:0043596 nuclear replication fork Cellular Component GO:0090575 RNA polymerase II transcription regulator complex Cellular Component GO:0001046 core promoter sequence-specific DNA binding Molecular Function GO:0001091 RNA polymerase II general transcription initiation factor binding Molecular Function GO:0003714 transcription corepressor activity Molecular Function |
| KEGG gene cross-reference | bta:540345 hsa:10589 mmu:66556 rno:293674 spo:2542201 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00808.30CBFD_NFYB_HMF8-71 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_023130 | PF00808.30 | CBFD_NFYB_HMF | 8 | 71 | 2.5e-19 | 70.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.