LXL04_023126 | RubberDandelionOmics

Gene overview

LXL04_023126

Reference: OH-1004 Chr: Chr05 Coordinates: 23968876-23973691 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2607 bp · LXL04_023126|LXL04_023126|OH1004|cDNA

ATGAACTTCAGTCCATGCTCGAGTAGTTCAGAGATCACATCCTATTGTTCGGAAAGTATAAACATCAATAAACCACAGTTCACATCTTCAATCAAGGCTACTGACATCACCACCAACAAAGACAGTATCCAGGTGTCTAGTCATGCTGCTAGAAAAGTAGGTGTTTCTTGTGAATATGTGGAAGGAACACGTTTAATTGAGAAACCACAGTCAAAGCCAAGAAAAAAGCTGGAATTTGTGAGGACATTGTTGATTGACAA...

CDS

Download CDS FASTA

2607 bp · LXL04_023126|LXL04_023126|OH1004|CDS

ATGAACTTCAGTCCATGCTCGAGTAGTTCAGAGATCACATCCTATTGTTCGGAAAGTATAAACATCAATAAACCACAGTTCACATCTTCAATCAAGGCTACTGACATCACCACCAACAAAGACAGTATCCAGGTGTCTAGTCATGCTGCTAGAAAAGTAGGTGTTTCTTGTGAATATGTGGAAGGAACACGTTTAATTGAGAAACCACAGTCAAAGCCAAGAAAAAAGCTGGAATTTGTGAGGACATTGTTGATTGACAA...

Protein

Download Protein FASTA

868 aa · LXL04_023126|LXL04_023126|OH1004|PROTEIN

MNFSPCSSSSEITSYCSESININKPQFTSSIKATDITTNKDSIQVSSHAARKVGVSCEYVEGTRLIEKPQSKPRKKLEFVRTLLIDNYDSYTYNIYQELSVVNGLPPVVVRNDEWTWEEACYYIYEERAFDNIVISPGPGSPACAADIGICLKLLLECGDIPILGVCLGHQALGYVHGANVVHAFEPVHGRLSEIQHNGSRLFNDIPSGTNSGFKVVRYHSLVIDPKSLPKELIPLAWTCSNDTISSSLVDQKFDQETSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023126`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023126

Location Chr05:23968876-23973691 (+)

Description Similar to ADCS: Aminodeoxychorismate synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28880`	Bifunctional enzyme that catalyzes the biosynthesis of 4- amino-4-deoxychorismate (ADC) from chorismate and glutamine.	The synthesis of pABA: Coupling between the glutamine amidotransferase and aminodeoxychorismate synthase domains of the bifunctional aminodeoxychorismate synthase from Arabidopsis thaliana.2011 · DOI: 10.1016/j.abb.2010.09.010

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0699700`	Bifunctional enzyme that catalyzes the biosynthesis of 4-amino-4-deoxychorismate (ADC) from chorismate and glutamine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023126 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0008153 4-aminobenzoate biosynthetic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0017000 antibiotic biosynthetic process Biological Process

GO:0046417 chorismate metabolic process Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046820 4-amino-4-deoxychorismate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28880

dosa:Os06g0699700

sly:543912

sve:SVEN_0920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.797

Rank 1 · LXL04_023126 · OH-1004

Mitochondrion0.178

Rank 2 · LXL04_023126 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_023126 · OH-1004

Peroxisome0.059

Rank 4 · LXL04_023126 · OH-1004

Nucleus0.057

Rank 5 · LXL04_023126 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117.35GATase83-245 aa

PF00117.35GATase271-307 aa

PF00425.26Chorismate_bind471-856 aa

PF30495.1Chorismate_bind_2516-854 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023126	`PF00117.35`	GATase	83	245	3.8e-40	138.3
LXL04_023126	`PF00117.35`	GATase	271	307	3.8e-40	138.3
LXL04_023126	`PF00425.26`	Chorismate_bind	471	856	7.3e-118	395.2
LXL04_023126	`PF30495.1`	Chorismate_bind_2	516	854	3.5e-42	145.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPN3`	Arabidopsis thaliana	Aminodeoxychorismate synthase, chloroplastic	59.328%	Swiss-Prot	strong database homology
`Q5Z856`	Oryza sativa subsp. japonica	Probable aminodeoxychorismate synthase, chloroplastic	59.042%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card