RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_023119
Reference: OH-1004 Chr: Chr05 Coordinates: 23821432-23822949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1518 bp · LXL04_023119|LXL04_023119|OH1004|cDNA

ATGGTTCTTGCAACCATACCTTCTCCGACCGtccccaccaccaccaccaccaccgccgcccCCGCCAGTGTGAGCTACAATGAATACATCAAAACAACCAACCACCACCGTCGTCTCCTCCACTTACTAAACCAATGCACCTCCATGTCTCACCTCAAACAAATCCACGCCCAAACACTCCgaaccacctccaccaccaaTCCCCACACGCTCTTCCTTCACAGTCGAATCCTCCATTTCTCATCTCTCCACGACCTCCA...

CDS

Download CDS FASTA

1518 bp · LXL04_023119|LXL04_023119|OH1004|CDS

ATGGTTCTTGCAACCATACCTTCTCCGACCGTCCCCACCACCACCACCACCACCGCCGCCCCCGCCAGTGTGAGCTACAATGAATACATCAAAACAACCAACCACCACCGTCGTCTCCTCCACTTACTAAACCAATGCACCTCCATGTCTCACCTCAAACAAATCCACGCCCAAACACTCCGAACCACCTCCACCACCAATCCCCACACGCTCTTCCTTCACAGTCGAATCCTCCATTTCTCATCTCTCCACGACCTCCA...

Protein

Download Protein FASTA

505 aa · LXL04_023119|LXL04_023119|OH1004|PROTEIN

MVLATIPSPTVPTTTTTTAAPASVSYNEYIKTTNHHRRLLHLLNQCTSMSHLKQIHAQTLRTTSTTNPHTLFLHSRILHFSSLHDLHYASLFFQTHIQNANSFAWNTIIKACSKSTNNKQDAIFLYLKMISESNVNVTPDKHTFPFVLKACAYLFAVSEGTQLHAHIIKLGLSSDVYINNSLIHFYGSCGRLKDAQDVFDEMPERTVVSWNVMIDTLVRLNEFDNAITCFRNMQTRFKPDSFTIQSILHACSGLGALSLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_023119
TK1151 IDTkA06G398870
OH-1004 IDLXL04_023119
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)91.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_023119
LocationChr05:23821432-23822949 (+)
DescriptionSimilar to PCMP-H51: Pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g59720 Involved in multiple sites RNA editing events in chloroplasts.
Pentatricopeptide repeat proteins with the DYW motif have distinct molecular functions in RNA editing and RNA cleavage in Arabidopsis chloroplasts.2009 · DOI: 10.1105/tpc.108.064667
At2g42920 Pentatricopeptide repeat-containing protein At2g42920, chloroplastic. No verified direct reference in this release
At4g21065 Pentatricopeptide repeat-containing protein At4g21065. No verified direct reference in this release
At2g02980 Involved in RNA editing event in chloroplasts.
A study of new Arabidopsis chloroplast RNA editing mutants reveals general features of editing factors and their target sites.2009 · DOI: 10.1105/tpc.109.071472
At2g36730 Pentatricopeptide repeat-containing protein At2g36730. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006397 mRNA processing Biological Process
GO:0009451 RNA modification Biological Process
GO:0016556 mRNA modification Biological Process
GO:0031425 chloroplast RNA processing Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0004519 endonuclease activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G59720
ath:AT2G02980
ath:AT2G36730
ath:AT2G42920
ath:AT4G21065
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.607
Rank 1 · LXL04_023119 · OH-1004
Plastid0.222
Rank 2 · LXL04_023119 · OH-1004
Nucleus0.054
Rank 3 · LXL04_023119 · OH-1004
Cytoplasm0.034
Rank 4 · LXL04_023119 · OH-1004
Cell membrane0.005
Rank 5 · LXL04_023119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2101-152 aa
PF12854.14PPR_1171-202 aa
PF01535.27PPR180-205 aa
PF13041.13PPR_2206-251 aa
PF13812.13PPR_3307-356 aa
PF13041.13PPR_2309-356 aa
PF01535.27PPR312-339 aa
PF17177.11PPR_long313-446 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_023119PF13041.13PPR_21011522.7e-42143.3
LXL04_023119PF12854.14PPR_11712027.5e-2380.7
LXL04_023119PF01535.27PPR1802054.9e-37124.3
LXL04_023119PF13041.13PPR_22062512.7e-42143.3
LXL04_023119PF13812.13PPR_33073561e-1558.2
LXL04_023119PF13041.13PPR_23093562.7e-42143.3
LXL04_023119PF01535.27PPR3123394.9e-37124.3
LXL04_023119PF17177.11PPR_long3134467.1e-0936.1
LXL04_023119PF20431.5E_motif4314922.6e-1247.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q0WQW5Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial52.883%Swiss-Protstrong database homology
Q9SJG6Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g42920, chloroplastic37.266%Swiss-Protmoderate database homology
A8MQA3Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g2106536.534%Swiss-Protmoderate database homology
Q8LK93Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g02980, chloroplastic36.076%Swiss-Protmoderate database homology
Q9ZQA1Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g3673036.229%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser