LXL04_022961 | RubberDandelionOmics

Gene overview

LXL04_022961

Reference: OH-1004 Chr: Chr05 Coordinates: 15516897-15527618 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2274 bp · LXL04_022961|LXL04_022961|OH1004|cDNA

ATGACTTTAAGAAGCCACGAGACTAAAAGACTGAAAAACTATTATCAACGTGGCGACATGGCTCTTAAAACGAACTCCGCCTCTCATCCTCTCAACCTCTGTTATCTCAATACACAAACAATAATCATCAACAGATTATACACATTCTGTCACTCCATAGCCATAACTTTCCTCATCTACTACAGAGCTTCCTCCATTCTCACCCTTATCCGCTCAAAAACCCAACAACCACTCCTCCCCCACCTCTTAATCTTCATCGC...

CDS

Download CDS FASTA

2274 bp · LXL04_022961|LXL04_022961|OH1004|CDS

ATGACTTTAAGAAGCCACGAGACTAAAAGACTGAAAAACTATTATCAACGTGGCGACATGGCTCTTAAAACGAACTCCGCCTCTCATCCTCTCAACCTCTGTTATCTCAATACACAAACAATAATCATCAACAGATTATACACATTCTGTCACTCCATAGCCATAACTTTCCTCATCTACTACAGAGCTTCCTCCATTCTCACCCTTATCCGCTCAAAAACCCAACAACCACTCCTCCCCCACCTCTTAATCTTCATCGC...

Protein

Download Protein FASTA

757 aa · LXL04_022961|LXL04_022961|OH1004|PROTEIN

MTLRSHETKRLKNYYQRGDMALKTNSASHPLNLCYLNTQTIIINRLYTFCHSIAITFLIYYRASSILTLIRSKTQQPLLPHLLIFIAELTLSFIWVLIQSFLWRPVTRTVFPERLPEDDQLPPIDVFICTADPEKEPPLGVMNTVVSAMSLDYPATKLTVYLSDDGGCPVTLEALREAWRFAKIWVPFCKKYGVKIICPEAYFAGGGVEDEVMVYSEEFAAEKVKVKGEYESFAHIVTTISESERCRSSKDHSSVVEVVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022961`
TK1151 ID	TkA06G422450
OH-1004 ID	LXL04_022961
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 95.985 / OH-1004 69.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022961

Location Chr05:15516897-15527618 (+)

Description Similar to CSLG2: Cellulose synthase-like protein G2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24000`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g24010`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g23990`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q651X6`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022961 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT4G23990

ath:AT4G24000

ath:AT4G24010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.323

Rank 1 · LXL04_022961 · OH-1004

Endoplasmic reticulum0.283

Rank 2 · LXL04_022961 · OH-1004

Golgi apparatus0.226

Rank 3 · LXL04_022961 · OH-1004

Lysosome / Vacuole0.134

Rank 4 · LXL04_022961 · OH-1004

Cytoplasm0.123

Rank 5 · LXL04_022961 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552.21Cellulose_synt124-402 aa

PF03552.21Cellulose_synt403-732 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022961	`PF03552.21`	Cellulose_synt	124	402	4.1e-134	449.5
LXL04_022961	`PF03552.21`	Cellulose_synt	403	732	4.1e-134	449.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYR4`	Arabidopsis thaliana	Cellulose synthase-like protein G2	35.705%	Swiss-Prot	moderate database homology
`Q570S7`	Arabidopsis thaliana	Cellulose synthase-like protein G1	36.450%	Swiss-Prot	moderate database homology
`Q0WVN5`	Arabidopsis thaliana	Cellulose synthase-like protein G3	35.596%	Swiss-Prot	moderate database homology
`Q651X6`	Oryza sativa subsp. japonica	Cellulose synthase-like protein E6	35.484%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card