LXL04_022905 | RubberDandelionOmics

Gene overview

LXL04_022905

Reference: OH-1004 Chr: Chr05 Coordinates: 13163692-13165028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_022905|LXL04_022905|OH1004|cDNA

ATGGCGGGGGTTTCAGCAAAGCCACTCTCTGCTTTATCCATTGCTTCAATACCCAAAATCGCTGCTAAATCCGAACAATCCCCAAACAGGATTAGGGTTTCAGGCAACGCAAATTGTTCTACTTCATTTGGTCTCAGATATAGAAGCAGCAACGATCCATGTACCAGTAGAAACAAGATTAGTAGATTGAATGCAGCCGGATTGACTGACATCGAACCTGATCTCAATGAAGATCCTGTAGATCGGTGGGACAACACCGG...

CDS

Download CDS FASTA

684 bp · LXL04_022905|LXL04_022905|OH1004|CDS

ATGGCGGGGGTTTCAGCAAAGCCACTCTCTGCTTTATCCATTGCTTCAATACCCAAAATCGCTGCTAAATCCGAACAATCCCCAAACAGGATTAGGGTTTCAGGCAACGCAAATTGTTCTACTTCATTTGGTCTCAGATATAGAAGCAGCAACGATCCATGTACCAGTAGAAACAAGATTAGTAGATTGAATGCAGCCGGATTGACTGACATCGAACCTGATCTCAATGAAGATCCTGTAGATCGGTGGGACAACACCGG...

Protein

Download Protein FASTA

227 aa · LXL04_022905|LXL04_022905|OH1004|PROTEIN

MAGVSAKPLSALSIASIPKIAAKSEQSPNRIRVSGNANCSTSFGLRYRSSNDPCTSRNKISRLNAAGLTDIEPDLNEDPVDRWDNTGISDDDFVYGKYDGHHTYNEADDKSTFWGSIAEDYAGVDPPTGFQGLISWLFPPAVALGMYLEVPGEYLYIGAAIFVVIFCIIEMDKPSEAYNFEPQIYNMEKGSRDKLISDYNTMDIWDFNEKYGDLWDFTVTKDDIMKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022905`
TK1151 ID	TkA06G429900
OH-1004 ID	LXL04_022905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022905

Location Chr05:13163692-13165028 (+)

Description Similar to PNSB5: Photosynthetic NDH subunit of subcomplex B 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43750`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

ath:AT5G43750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · LXL04_022905 · OH-1004

Mitochondrion0.020

Rank 2 · LXL04_022905 · OH-1004

Nucleus0.016

Rank 3 · LXL04_022905 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_022905 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_022905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28784.1PnsB5_helical128-171 aa

PF28765.1PNSB5_C177-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022905	`PF28784.1`	PnsB5_helical	128	171	6e-25	87.9
LXL04_022905	`PF28765.1`	PNSB5_C	177	227	1.7e-33	114.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG89`	Arabidopsis thaliana	Photosynthetic NDH subunit of subcomplex B 5, chloroplastic	53.394%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card