LXL04_022779 | RubberDandelionOmics

Gene overview

LXL04_022779

Reference: OH-1004 Chr: Chr05 Coordinates: 8909347-8912335 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · LXL04_022779|LXL04_022779|OH1004|cDNA

ATGTTTGGGCGTGTTCCAAAAAAGAGTGATAATACAAAGTATTATGAAGTTCTTGGTGTCCCACAATCTGCCACTCCAGATGAATTAAAGAAGGCTTACCGTAAGGCTGCCATAAAGAACCATCCTGATAAAGGTGGTGACCCTGAGAAGTTCAAGGAATTGGCACAAGCATATGAAGTTCTTAATGATCCAGAAAAAAGAGAGATATATGATGAATATGGTGAAGATGCTCTGAAAGAGGGCATGGGAGGTGGTGGCAG...

CDS

Download CDS FASTA

1275 bp · LXL04_022779|LXL04_022779|OH1004|CDS

ATGTTTGGGCGTGTTCCAAAAAAGAGTGATAATACAAAGTATTATGAAGTTCTTGGTGTCCCACAATCTGCCACTCCAGATGAATTAAAGAAGGCTTACCGTAAGGCTGCCATAAAGAACCATCCTGATAAAGGTGGTGACCCTGAGAAGTTCAAGGAATTGGCACAAGCATATGAAGTTCTTAATGATCCAGAAAAAAGAGAGATATATGATGAATATGGTGAAGATGCTCTGAAAGAGGGCATGGGAGGTGGTGGCAG...

Protein

Download Protein FASTA

424 aa · LXL04_022779|LXL04_022779|OH1004|PROTEIN

MFGRVPKKSDNTKYYEVLGVPQSATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLNDPEKREIYDEYGEDALKEGMGGGGSSSESPFDIFEQFFGGGGGFGGGFGGGGGSRTRKKQGEDVKQVLKVSLEEVYNGITKKLSLSRNILCKKCKGKGSKSGASSRCFGCQGSGMRVTTRQIGPGMIQQMQHVCPECRGSGESISERDRCQPCKGKKVTQEKRVLEVHVEKGMQNGQKIVFEGQADEAPDTVTGDIVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022779`
TK1151 ID	TkA06G447320
OH-1004 ID	LXL04_022779
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022779

Location Chr05:8909347-8912335 (-)

Description Similar to DJA6: Chaperone protein dnaJ A6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22060`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0549600`	Involved in disease resistance.	The DnaJ protein OsDjA6 negatively regulates rice innate immunity to the blast fungus Magnaporthe oryzae.2018 · DOI: 10.1111/mpp.12546

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022779 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT5G22060

dosa:Os04g0549600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.682

Rank 1 · LXL04_022779 · OH-1004

Nucleus0.370

Rank 2 · LXL04_022779 · OH-1004

Cell membrane0.129

Rank 3 · LXL04_022779 · OH-1004

Endoplasmic reticulum0.108

Rank 4 · LXL04_022779 · OH-1004

Mitochondrion0.079

Rank 5 · LXL04_022779 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ13-71 aa

PF01556.24DnaJ_C128-348 aa

PF00684.26DnaJ_CXXCXGXG153-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022779	`PF00226.37`	DnaJ	13	71	3e-23	82.4
LXL04_022779	`PF01556.24`	DnaJ_C	128	348	1.4e-36	126.6
LXL04_022779	`PF00684.26`	DnaJ_CXXCXGXG	153	219	9.3e-15	55.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42825`	Arabidopsis thaliana	Chaperone protein dnaJ 2	68.852%	Swiss-Prot	strong database homology
`Q0JB88`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A6	69.718%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card