LXL04_022764 | RubberDandelionOmics

Gene overview

LXL04_022764

Reference: OH-1004 Chr: Chr05 Coordinates: 8430841-8432352 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · LXL04_022764|LXL04_022764|OH1004|cDNA

ATGATTCGATCTTCTTCACGTTCTTTGTACAAATTAAGTAGCCAGTGTAGATCCTCGTTATCTGTTTCCTCATGTCGATCACCGCCCTCGTCACTGATCACTGCAACCGCCGTTCGGCGGTCCACAACCGACTTGGCGTTAGGAAATAGAATAGAAACCGGAAAGTTCAGCTCGTTAGTTTCTCTACGGACAAGATTCCAAGTTTCGAGTAGTAATGGAGCTTGTAATGTCGGTGTTTCTGAAGCGAGATCGTTTGCATC...

CDS

Download CDS FASTA

804 bp · LXL04_022764|LXL04_022764|OH1004|CDS

ATGATTCGATCTTCTTCACGTTCTTTGTACAAATTAAGTAGCCAGTGTAGATCCTCGTTATCTGTTTCCTCATGTCGATCACCGCCCTCGTCACTGATCACTGCAACCGCCGTTCGGCGGTCCACAACCGACTTGGCGTTAGGAAATAGAATAGAAACCGGAAAGTTCAGCTCGTTAGTTTCTCTACGGACAAGATTCCAAGTTTCGAGTAGTAATGGAGCTTGTAATGTCGGTGTTTCTGAAGCGAGATCGTTTGCATC...

Protein

Download Protein FASTA

267 aa · LXL04_022764|LXL04_022764|OH1004|PROTEIN

MIRSSSRSLYKLSSQCRSSLSVSSCRSPPSSLITATAVRRSTTDLALGNRIETGKFSSLVSLRTRFQVSSSNGACNVGVSEARSFASKASRSTSEKASESRKAVTTVEDPFDAPTYNIPEKPMTFTEGASYSVVILVGLGIAAAAGYGVFKELIFEPKEYKVFNKALRRIQDDSQVRVRIGSPITGYGQESRNRAARQRIPNRIWKDDDGVEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFMYLQVEINSPSQSRML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022764`
TK1151 ID	TkA06G450160
OH-1004 ID	LXL04_022764
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022764

Location Chr05:8430841-8432352 (-)

Description Similar to TIM21: Probable mitochondrial import inner membrane translocase subunit TIM21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00026`	May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022764 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0033617 mitochondrial respiratory chain complex IV assembly Biological Process

GO:0090351 seedling development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

afm:AFUA_2G09820

ath:AT4G00026

bta:614633

mmu:67105

xla:494838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.941

Rank 1 · LXL04_022764 · OH-1004

Nucleus0.057

Rank 2 · LXL04_022764 · OH-1004

Cytoplasm0.047

Rank 3 · LXL04_022764 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_022764 · OH-1004

Plastid0.013

Rank 5 · LXL04_022764 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08294.18TIM21125-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022764	`PF08294.18`	TIM21	125	260	7.9e-24	84.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3L1`	Arabidopsis thaliana	Probable mitochondrial import inner membrane translocase subunit TIM21	74.595%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card