LXL04_022728 | RubberDandelionOmics

Gene overview

LXL04_022728

Reference: OH-1004 Chr: Chr05 Coordinates: 7068463-7077831 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_022728|LXL04_022728|OH1004|cDNA

ATGAGTTCAAATCCTAGCACTAGTAGCACCagcggtggcggtggtggaagtggtggtgGTGGGCCTTGCGGAGCTTGCAAGTTCTTGAGGAGGAAATGTGTTGCAGGGTGTATATTTGCACCATATTTCGATTCCGATCAAGGTGCAGCCCATTTCGCCGCCGTGCATAAAGTGTTTGGAGCTAGTAATGTCTCTAAACTCTTGTTTCATCTTCCTGTACAACGACGGCATGAGGCGGTGGTCACCATTTGTTATGAAGC...

CDS

Download CDS FASTA

834 bp · LXL04_022728|LXL04_022728|OH1004|CDS

ATGAGTTCAAATCCTAGCACTAGTAGCACCAGCGGTGGCGGTGGTGGAAGTGGTGGTGGTGGGCCTTGCGGAGCTTGCAAGTTCTTGAGGAGGAAATGTGTTGCAGGGTGTATATTTGCACCATATTTCGATTCCGATCAAGGTGCAGCCCATTTCGCCGCCGTGCATAAAGTGTTTGGAGCTAGTAATGTCTCTAAACTCTTGTTTCATCTTCCTGTACAACGACGGCATGAGGCGGTGGTCACCATTTGTTATGAAGC...

Protein

Download Protein FASTA

277 aa · LXL04_022728|LXL04_022728|OH1004|PROTEIN

MSSNPSTSSTSGGGGGSGGGGPCGACKFLRRKCVAGCIFAPYFDSDQGAAHFAAVHKVFGASNVSKLLFHLPVQRRHEAVVTICYEAQARLKDPVYGCISHIFALQQQSANVTPKILEGGNVLVGFAAHVLSQGTPVNQVVNLQAELSYFQAHLATLEGPSPQQIPPPQPTTLSPGITINDIQTPTSLLGSYDLSSLLEPMMTPSWNMQPPNRRQIDPRGFMSVGTTRALDMAPSQGSTGDLRELARELLQRPSSVSSMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022728`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022728

Location Chr05:7068463-7077831 (-)

Description Similar to LBD30: LOB domain-containing protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00220`	Involved in the positive regulation of tracheary element (TE) differentiation.	ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061796
`At2g45420`	Involved in the positive regulation of tracheary element (TE) differentiation.	ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061796 LBD18/ASL20 regulates lateral root formation in combination with LBD16/ASL18 downstream of ARF7 and ARF19 in Arabidopsis.2009 · DOI: 10.1104/pp.109.143685 LBD18 acts as a transcriptional activator that directly binds to the EXPANSIN14 promoter in promoting lateral root emergence of Arabidopsis.2013 · DOI: 10.1111/tpj.12013 The AP2/EREBP gene PUCHI Co-Acts with LBD16/ASL18 and LBD18/ASL20 downstream of ARF7 and ARF19 to regulate lateral root development in Arabidopsis.2013 · DOI: 10.1093/pcp/pct081 EXPANSINA17 up-regulated by LBD18/ASL20 promotes lateral root formation during the auxin response.2013 · DOI: 10.1093/pcp/pct105 Lateral Organ Boundaries Domain16 and 18 Act Downstream of the AUXIN1 and LIKE-AUXIN3 Auxin Influx Carriers to Control Lateral Root Development in Arabidopsis.2015 · DOI: 10.1104/pp.15.00578
`At4g00210`	LOB domain-containing protein 31.	No verified direct reference in this release
`At2g42430`	Transcriptional activator.	ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047761 LBD18/ASL20 regulates lateral root formation in combination with LBD16/ASL18 downstream of ARF7 and ARF19 in Arabidopsis.2009 · DOI: 10.1104/pp.109.143685 The AP2/EREBP gene PUCHI Co-Acts with LBD16/ASL18 and LBD18/ASL20 downstream of ARF7 and ARF19 to regulate lateral root development in Arabidopsis.2013 · DOI: 10.1093/pcp/pct081 Lateral Organ Boundaries Domain16 and 18 Act Downstream of the AUXIN1 and LIKE-AUXIN3 Auxin Influx Carriers to Control Lateral Root Development in Arabidopsis.2015 · DOI: 10.1104/pp.15.00578
`At3g03760`	LOB domain-containing protein 20.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022728 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010089 xylem development Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0010311 lateral root formation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

KEGG gene cross-reference

ath:AT2G42430

ath:AT2G45420

ath:AT3G03760

ath:AT4G00210

ath:AT4G00220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_022728 · OH-1004

Cytoplasm0.126

Rank 2 · LXL04_022728 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_022728 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_022728 · OH-1004

Plastid0.016

Rank 5 · LXL04_022728 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195.20LOB22-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022728	`PF03195.20`	LOB	22	114	1e-33	116.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81323`	Arabidopsis thaliana	LOB domain-containing protein 30	51.092%	Swiss-Prot	strong database homology
`O22131`	Arabidopsis thaliana	LOB domain-containing protein 18	48.425%	Swiss-Prot	moderate database homology
`O81322`	Arabidopsis thaliana	LOB domain-containing protein 31	42.041%	Swiss-Prot	moderate database homology
`Q9SLB7`	Arabidopsis thaliana	LOB domain-containing protein 16	69.091%	Swiss-Prot	weak database homology
`Q9SRV3`	Arabidopsis thaliana	LOB domain-containing protein 20	78.947%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card