LXL04_022691 | RubberDandelionOmics

Gene overview

LXL04_022691

Reference: OH-1004 Chr: Chr05 Coordinates: 4895245-4899329 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_022691|LXL04_022691|OH1004|cDNA

ATGTCGGATGTGAACCAAGAACCTTTAAATTACATCGAATCAACCTCCACCAACTTTGACACACTCCGTTTGTACGTCTTCTGCTCCATTTCTTTCTCCCCTTTTATACAACCGCACCATCTCTTACTTGCAGAGAattctagagagagaaaacacAGAAATACAGAATCCATTGTTATGGGGAGAGGAAGAGTGGAGCTCAAGAGAATCGAGAACAAAATCAACCGACAAGTTACCTTCTCAAAACGAAGAAATGGTCT...

CDS

Download CDS FASTA

927 bp · LXL04_022691|LXL04_022691|OH1004|CDS

ATGTCGGATGTGAACCAAGAACCTTTAAATTACATCGAATCAACCTCCACCAACTTTGACACACTCCGTTTGTACGTCTTCTGCTCCATTTCTTTCTCCCCTTTTATACAACCGCACCATCTCTTACTTGCAGAGAATTCTAGAGAGAGAAAACACAGAAATACAGAATCCATTGTTATGGGGAGAGGAAGAGTGGAGCTCAAGAGAATCGAGAACAAAATCAACCGACAAGTTACCTTCTCAAAACGAAGAAATGGTCT...

Protein

Download Protein FASTA

308 aa · LXL04_022691|LXL04_022691|OH1004|PROTEIN

MSDVNQEPLNYIESTSTNFDTLRLYVFCSISFSPFIQPHHLLLAENSRERKHRNTESIVMGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVGLIIFSSRDKLYEFGSVGVMKTLERYQRCCFNPQDNNNERETQSWYQEVSKLKAKFESLQRTQRHLLGEDLGPLSVKELHNLEKQLEGALTQARQRKTQIMVEQMEELRRKERELGDMNKHLKIKVSHELSTFDNEGQGYRAQLPCPWNSPGNNNTSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022691`
TK1151 ID	TkA06G465480
OH-1004 ID	LXL04_022691
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 59.416 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022691

Location Chr05:4895245-4899329 (-)

Description Similar to MADS3: Agamous-like MADS-box protein MADS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45650`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0682200`	Probable transcription factor.	MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice.2009 · DOI: 10.1105/tpc.109.068742
`Os04g0580700`	Probable transcription factor.	MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice.2009 · DOI: 10.1105/tpc.109.068742

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022691 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010022 meristem determinacy Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010094 specification of carpel identity Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT2G45650

dosa:Os02g0682200

sly:101268317

vvi:100232868

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_022691 · OH-1004

Cytoplasm0.106

Rank 2 · LXL04_022691 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_022691 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_022691 · OH-1004

Plastid0.013

Rank 5 · LXL04_022691 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF69-116 aa

PF01486.23K-box139-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022691	`PF00319.24`	SRF-TF	69	116	1.9e-26	92.0
LXL04_022691	`PF01486.23`	K-box	139	228	8e-30	103.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29386`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL6	61.538%	Swiss-Prot	strong database homology
`Q6EU39`	Oryza sativa subsp. japonica	MADS-box transcription factor 6	66.148%	Swiss-Prot	strong database homology
`Q7XUN2`	Oryza sativa subsp. japonica	MADS-box transcription factor 17	62.553%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card