LXL04_022577 | RubberDandelionOmics

Gene overview

LXL04_022577

Reference: OH-1004 Chr: Chr05 Coordinates: 1748907-1751765 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2163 bp · LXL04_022577|LXL04_022577|OH1004|cDNA

ATGAAGTTCAAACATGAAAGATACACAAGGTTTAACAACACAAGCTCGGAGCAATCTTATACATCTAATCAACGAATCCCCACAAAATATGGAGTAAAGCCATATTTCAGGTCACTGATGAATACGATACAAAGAGGATTAAAGCATGGGGTTAGTGGATTAAAGAATTCAGTAATCTTCCATCAATCGAGTGATAAACCAGTTACAAAGCAAGTAGTTTCGAAGAAGAAATCGAAAATCCTGGATCCACAAGGATCCTT...

CDS

Download CDS FASTA

2163 bp · LXL04_022577|LXL04_022577|OH1004|CDS

ATGAAGTTCAAACATGAAAGATACACAAGGTTTAACAACACAAGCTCGGAGCAATCTTATACATCTAATCAACGAATCCCCACAAAATATGGAGTAAAGCCATATTTCAGGTCACTGATGAATACGATACAAAGAGGATTAAAGCATGGGGTTAGTGGATTAAAGAATTCAGTAATCTTCCATCAATCGAGTGATAAACCAGTTACAAAGCAAGTAGTTTCGAAGAAGAAATCGAAAATCCTGGATCCACAAGGATCCTT...

Protein

Download Protein FASTA

720 aa · LXL04_022577|LXL04_022577|OH1004|PROTEIN

MKFKHERYTRFNNTSSEQSYTSNQRIPTKYGVKPYFRSLMNTIQRGLKHGVSGLKNSVIFHQSSDKPVTKQVVSKKKSKILDPQGSFLQKWNKIFVLICVVAVSLDPLFFYVPVIDGHQKCLGMDRNMKIISCVLRTVIDLIYILHIIFEFRTGFIAPPSRIFGRGELIEDSFLIAKRYFYSHFIIDLLAILPLPQVTILFIIPLSDGPVSLVTKDLIKFVIFAQYVPRFLRIFPLYREVTRTSGIFTETPWAGAAFNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022577`
TK1151 ID	TkA06G475390
OH-1004 ID	LXL04_022577
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022577

Location Chr05:1748907-1751765 (-)

Description Similar to CNGC1: Cyclic nucleotide-gated ion channel 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53130`	Acts as a cyclic nucleotide-gated ion channel.	Expression of a truncated tobacco NtCBP4 channel in transgenic plants and disruption of the homologous Arabidopsis CNGC1 gene confer Pb2+ tolerance.2000 · DOI: 10.1046/j.1365-313x.2000.00901.x Electrophysiological analysis of cloned cyclic nucleotide-gated ion channels.2002 · DOI: 10.1104/pp.010832
`At1g01340`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g01010`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At2g46430`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30560`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022577 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005242 inward rectifier potassium channel activity Molecular Function

GO:0005249 voltage-gated potassium channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0030552 cAMP binding Molecular Function

GO:0030553 cGMP binding Molecular Function

KEGG gene cross-reference

ath:AT1G01340

ath:AT2G46430

ath:AT4G01010

ath:AT4G30560

ath:AT5G53130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.893

Rank 1 · LXL04_022577 · OH-1004

Cytoplasm0.090

Rank 2 · LXL04_022577 · OH-1004

Endoplasmic reticulum0.055

Rank 3 · LXL04_022577 · OH-1004

Nucleus0.026

Rank 4 · LXL04_022577 · OH-1004

Golgi apparatus0.021

Rank 5 · LXL04_022577 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans93-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022577	`PF00520.38`	Ion_trans	93	413	1.3e-18	67.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65717`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 1	63.923%	Swiss-Prot	strong database homology
`Q9LNJ0`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 10	58.726%	Swiss-Prot	strong database homology
`Q9LD40`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 13	57.873%	Swiss-Prot	strong database homology
`Q9SKD7`	Arabidopsis thaliana	Probable cyclic nucleotide-gated ion channel 3	55.000%	Swiss-Prot	strong database homology
`Q9M0A4`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 9	51.370%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card