LXL04_022562 | RubberDandelionOmics

Gene overview

LXL04_022562

Reference: OH-1004 Chr: Chr05 Coordinates: 1605641-1608852 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2085 bp · LXL04_022562|LXL04_022562|OH1004|cDNA

ATGGCTTCGAATTCGAGCGAACGTAACAACACAAATCCTTCCAGTTTGGTCGATGAACTTCAATTTGATATGGACGATGATCAACCGATGGTTGAAACGTCAGGTGTAGAGAAAAGTCTGTTATCGACGGTGTCTGAGCAGGAGAGCGATACAGCTGATGAGATCTGGCGTAACATCGAGACTAACCGTGTTCGATTCCCGACGCACCGTGATGATCATAGAGAAGGATTGAAGAGAACTACTACATTGAAATCTCCACC...

CDS

Download CDS FASTA

2085 bp · LXL04_022562|LXL04_022562|OH1004|CDS

ATGGCTTCGAATTCGAGCGAACGTAACAACACAAATCCTTCCAGTTTGGTCGATGAACTTCAATTTGATATGGACGATGATCAACCGATGGTTGAAACGTCAGGTGTAGAGAAAAGTCTGTTATCGACGGTGTCTGAGCAGGAGAGCGATACAGCTGATGAGATCTGGCGTAACATCGAGACTAACCGTGTTCGATTCCCGACGCACCGTGATGATCATAGAGAAGGATTGAAGAGAACTACTACATTGAAATCTCCACC...

Protein

Download Protein FASTA

694 aa · LXL04_022562|LXL04_022562|OH1004|PROTEIN

MASNSSERNNTNPSSLVDELQFDMDDDQPMVETSGVEKSLLSTVSEQESDTADEIWRNIETNRVRFPTHRDDHREGLKRTTTLKSPPGADGEAVPTIDDSSKQSTPTSPTGTDGGGRDGESSDKEKIGRGSLENKTILKPSPSVGTSLVNLVNEATGARANCAENGSSSMMDEAWERLRSSYVYFQKKPVGTLAAVDPSAEALNYNQAHTNARSAYLLINVQTVETIMLHKFNRLASDTTIDNAGYSIMDQLIVYRFGLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022562`
TK1151 ID	TkA06G476290
OH-1004 ID	LXL04_022562
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 55.187 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022562

Location Chr05:1605641-1608852 (-)

Description Similar to CINV2: Alkaline/neutral invertase CINV2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09510`	Cytosolic invertase that may cleave sucrose into glucose and fructose, and that is involved in the regulation of root growth.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106
`At4g34860`	Invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release
`At1g35580`	Cytosolic invertase that specifically cleaves sucrose into glucose and fructose and is involved in the regulation of multiple tissue development including primary root elongation, root hair growth, leaf and silique development, and floral transition.	PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth.2007 · DOI: 10.1105/tpc.106.045658 Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106 Exploring the neutral invertase-oxidative stress defence connection in Arabidopsis thaliana.2011 · DOI: 10.1093/jxb/err069 Cytosolic invertases contribute to cellulose biosynthesis and influence carbon partitioning in seedlings of Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13909
`At1g72000`	Invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0550600`	Cytosolic invertase that cleaves sucrose into glucose and fructose and is involved in the regulation of primary root elongation, lateral root formation, floral transition and pollen development.	OsCYT-INV1 for alkaline/neutral invertase is involved in root cell development and reproductivity in rice (Oryza sativa L.).2008 · DOI: 10.1007/s00425-008-0718-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022562 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005987 sucrose catabolic process Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0010311 lateral root formation Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0048364 root development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G35580

ath:AT1G72000

ath:AT4G09510

ath:AT4G34860

dosa:Os02g0550600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.395

Rank 1 · LXL04_022562 · OH-1004

Nucleus0.262

Rank 2 · LXL04_022562 · OH-1004

Cell membrane0.191

Rank 3 · LXL04_022562 · OH-1004

Mitochondrion0.145

Rank 4 · LXL04_022562 · OH-1004

Endoplasmic reticulum0.106

Rank 5 · LXL04_022562 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12899.14Glyco_hydro_100174-209 aa

PF12899.14Glyco_hydro_100261-665 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022562	`PF12899.14`	Glyco_hydro_100	174	209	1.7e-207	690.1
LXL04_022562	`PF12899.14`	Glyco_hydro_100	261	665	1.7e-207	690.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XD9`	Arabidopsis thaliana	Alkaline/neutral invertase CINV2	61.872%	Swiss-Prot	strong database homology
`Q9SW48`	Arabidopsis thaliana	Probable alkaline/neutral invertase B	65.209%	Swiss-Prot	strong database homology
`Q9LQF2`	Arabidopsis thaliana	Alkaline/neutral invertase CINV1	66.284%	Swiss-Prot	strong database homology
`Q9C560`	Arabidopsis thaliana	Probable alkaline/neutral invertase F	65.966%	Swiss-Prot	strong database homology
`Q69T31`	Oryza sativa subsp. japonica	Cytosolic invertase 1	65.636%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card