Gene Card
Gene overview
cDNA / CDS / Protein Sequences
636 bp · LXL04_022435|LXL04_022435|OH1004|cDNA
ATGTACTGCCACATGTACTTCTTCATCTTCCTTCTCCAGCTCCCAACTCCTCTTGTCGTTCATCACACTCACATCCGGTTCTTCACAATATCAAACTTGTCAATAACTTCGACGAATTTGTTGCAGTCCCCTGACATTTACCCGTCCCAGTATCCAACTCCGACGGCGAGAAGCTTCGGCGGTGGACGACGGACACCGTTGTCGATCGTCTCCGATGcatttctcttcttctccggcgcCGTAGCCGCTCTATTACTCAT...
636 bp · LXL04_022435|LXL04_022435|OH1004|CDS
ATGTACTGCCACATGTACTTCTTCATCTTCCTTCTCCAGCTCCCAACTCCTCTTGTCGTTCATCACACTCACATCCGGTTCTTCACAATATCAAACTTGTCAATAACTTCGACGAATTTGTTGCAGTCCCCTGACATTTACCCGTCCCAGTATCCAACTCCGACGGCGAGAAGCTTCGGCGGTGGACGACGGACACCGTTGTCGATCGTCTCCGATGCATTTCTCTTCTTCTCCGGCGCCGTAGCCGCTCTATTACTCAT...
Protein
Download Protein FASTA211 aa · LXL04_022435|LXL04_022435|OH1004|PROTEIN
MYCHMYFFIFLLQLPTPLVVHHTHIRFFTISNLSITSTNLLQSPDIYPSQYPTPTARSFGGGRRTPLSIVSDAFLFFSGAVAALLLIWTFSTFSNHQPQPTSNLDPKSPVSVIDNVVMLVTYNRETDQSRGFGFVTMSTVEEADKAVEMLHRYRVYVGNLPWDVDDVGLEQLFSEHGKVVNARVGFVTISSESEVNDAFEDLDAQGRNGKF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_022435 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_022435 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:150344794-150345982 (-) | |||||||||
| Description | Similar to 28 kDa ribonucleoprotein, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006396 RNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0009409 response to cold Biological Process GO:0009451 RNA modification Biological Process GO:0009631 cold acclimation Biological Process GO:0016553 base conversion or substitution editing Biological Process GO:0043489 RNA stabilization Biological Process GO:0045087 innate immune response Biological Process GO:1901259 chloroplast rRNA processing Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G24770 ath:AT5G50250 nsy:104227036 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00076.29RRM_1121-152 aaPF00076.29RRM_1155-206 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_022435 | PF00076.29 | RRM_1 | 121 | 152 | 5.7e-16 | 58.9 |
| LXL04_022435 | PF00076.29 | RRM_1 | 155 | 206 | 5.7e-16 | 58.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.