LXL04_022408 | RubberDandelionOmics

Gene overview

LXL04_022408

Reference: OH-1004 Chr: Chr04 Coordinates: 149637529-149640586 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · LXL04_022408|LXL04_022408|OH1004|cDNA

ATGGAGCAGCATTTACAAAATCCTGTTTCAGGTCACCCAAAATCTCAAATAACCTCAACAATATTTCAAGAAGTGGAAAGCGAATGGGGGATTCGACACATAATGGATCCATATGAAGCATCAAAGGACATCAGCTTGTTTTCAAGCTCATTGCCTGTCATTCCACATAAAAAATGTGGTAGTGAAGATACACTTGGTGATATCATTAACAGTTTAACCGAAAGCATGCTTCCTGGTGATGAAGATGACCTATTAGCCGG...

CDS

Download CDS FASTA

2118 bp · LXL04_022408|LXL04_022408|OH1004|CDS

ATGGAGCAGCATTTACAAAATCCTGTTTCAGGTCACCCAAAATCTCAAATAACCTCAACAATATTTCAAGAAGTGGAAAGCGAATGGGGGATTCGACACATAATGGATCCATATGAAGCATCAAAGGACATCAGCTTGTTTTCAAGCTCATTGCCTGTCATTCCACATAAAAAATGTGGTAGTGAAGATACACTTGGTGATATCATTAACAGTTTAACCGAAAGCATGCTTCCTGGTGATGAAGATGACCTATTAGCCGG...

Protein

Download Protein FASTA

705 aa · LXL04_022408|LXL04_022408|OH1004|PROTEIN

MEQHLQNPVSGHPKSQITSTIFQEVESEWGIRHIMDPYEASKDISLFSSSLPVIPHKKCGSEDTLGDIINSLTESMLPGDEDDLLAGINDDFDLADLPTQLEDLEDDLFESGGGMEMDDGIRFGHSNLSMSDGVPFIGGNRHELPHTGNNVVVGEHPYGEHPSRTLFVRNINSNVEDSELKSLFEEYGEIRNLYTACKHRGFVMISYYDIRHARIAMRELQNKPLRRRKLDIHFSIPKDNPSEKDINQGTLVVFNLDSSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022408`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022408

Location Chr04:149637529-149640586 (+)

Description Similar to ML2: Protein MEI2-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29400`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At4g18120`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At2g42890`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	The Arabidopsis Mei2 homologue AML1 binds AtRaptor1B, the plant homologue of a major regulator of eukaryotic cell growth.2005 · DOI: 10.1186/1471-2229-5-2 The Arabidopsis-mei2-like genes play a role in meiosis and vegetative growth in Arabidopsis.2006 · DOI: 10.1105/tpc.105.039156

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0719800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0319100`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022408 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29400

ath:AT2G42890

dosa:Os02g0319100

dosa:Os02g0719800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.579

Rank 1 · LXL04_022408 · OH-1004

Cytoplasm0.424

Rank 2 · LXL04_022408 · OH-1004

Cell membrane0.086

Rank 3 · LXL04_022408 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_022408 · OH-1004

Lysosome / Vacuole0.031

Rank 5 · LXL04_022408 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1166-230 aa

PF13893.13RRM_5248-323 aa

PF16842.12RRM_occluded250-316 aa

PF00076.29RRM_1251-316 aa

PF04059.19RRM_2544-640 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022408	`PF00076.29`	RRM_1	166	230	2.9e-29	101.5
LXL04_022408	`PF13893.13`	RRM_5	248	323	1.6e-11	44.7
LXL04_022408	`PF16842.12`	RRM_occluded	250	316	5.9e-10	39.6
LXL04_022408	`PF00076.29`	RRM_1	251	316	2.9e-29	101.5
LXL04_022408	`PF04059.19`	RRM_2	544	640	7.4e-54	180.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWF5`	Arabidopsis thaliana	Protein MEI2-like 5	51.809%	Swiss-Prot	strong database homology
`Q9SVV9`	Arabidopsis thaliana	Protein MEI2-like 3	51.271%	Swiss-Prot	strong database homology
`Q9SJG8`	Arabidopsis thaliana	Protein MEI2-like 2	44.254%	Swiss-Prot	moderate database homology
`Q6ZI17`	Oryza sativa subsp. japonica	Protein MEI2-like 2	50.558%	Swiss-Prot	strong database homology
`Q6EQX3`	Oryza sativa subsp. japonica	Protein MEI2-like 5	46.536%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card