LXL04_022392 | RubberDandelionOmics

Gene overview

LXL04_022392

Reference: OH-1004 Chr: Chr04 Coordinates: 149492577-149494904 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1706 bp · LXL04_022392|LXL04_022392|OH1004|cDNA

TCATCATGTCGGATCTTGAGGCCCCACTAGTCCGCCCGAAAAGAAAGAAAGTGTGGGTGGACTACTTCGTCCAATTCAGATGGATTCTTGTCATCTTCGTAGTCCTCCCAATCTCCTTCACCCTCTACTTCCTCACCTACCTAGGTGACGTCAGATCCGAATGGAAATCCTACAAAAAAAGGCAAGAAGAACACGAACAAAACGTCAAGAAAGTCGTCAAACGTCTCAAAGAACGAAACCCATCAAAAGACGGGCTCGTG...

CDS

Download CDS FASTA

1701 bp · LXL04_022392|LXL04_022392|OH1004|CDS

ATGTCGGATCTTGAGGCCCCACTAGTCCGCCCGAAAAGAAAGAAAGTGTGGGTGGACTACTTCGTCCAATTCAGATGGATTCTTGTCATCTTCGTAGTCCTCCCAATCTCCTTCACCCTCTACTTCCTCACCTACCTAGGTGACGTCAGATCCGAATGGAAATCCTACAAAAAAAGGCAAGAAGAACACGAACAAAACGTCAAGAAAGTCGTCAAACGTCTCAAAGAACGAAACCCATCAAAAGACGGGCTCGTGTGCAC...

Protein

Download Protein FASTA

566 aa · LXL04_022392|LXL04_022392|OH1004|PROTEIN

MSDLEAPLVRPKRKKVWVDYFVQFRWILVIFVVLPISFTLYFLTYLGDVRSEWKSYKKRQEEHEQNVKKVVKRLKERNPSKDGLVCTARKPWIAVGMRNVDYKRARHFEVDLSAFRNILEIDQERMIAKCEPLVNMGQITRTTVPMNLALAVVAELDDLTVGGLINGYGIEGSSHLYGLFSDTVVAYEICLADGKVVRATKDNEYSDLFYAIPWSQGTLGFLMSAEIKLIPIKEYMKLTYKPVRGNVKDLGQAYIDSFAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022392`
TK1151 ID	TkA05G464280
OH-1004 ID	LXL04_022392
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 83.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022392

Location Chr04:149492577-149494904 (-)

Description Similar to DIM: Delta(24)-sterol reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19820`	Plays a critical role in the general process of plant cell elongation.	The Arabidopsis dwarf1 mutant is defective in the conversion of 24-methylenecholesterol to campesterol in brassinosteroid biosynthesis.1999 · DOI: 10.1104/pp.119.3.897 The Arabidopsis DIMINUTO/DWARF1 gene encodes a protein involved in steroid synthesis.1998 · DOI: 10.1105/tpc.10.10.1677

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022392 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0007265 Ras protein signal transduction Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009725 response to hormone Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

KEGG gene cross-reference

ath:AT3G19820

hsa:1718

mmu:74754

rno:298298

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.823

Rank 1 · LXL04_022392 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_022392 · OH-1004

Golgi apparatus0.090

Rank 3 · LXL04_022392 · OH-1004

Cell membrane0.075

Rank 4 · LXL04_022392 · OH-1004

Nucleus0.061

Rank 5 · LXL04_022392 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565.29FAD_binding_4110-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022392	`PF01565.29`	FAD_binding_4	110	199	2.5e-14	53.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39085`	Arabidopsis thaliana	Delta(24)-sterol reductase	79.041%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card