LXL04_022358 | RubberDandelionOmics

Gene overview

LXL04_022358

Reference: OH-1004 Chr: Chr04 Coordinates: 149093988-149096949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1060 bp · LXL04_022358|LXL04_022358|OH1004|cDNA

ATGGAGACGCAAGCAGGTCGAACGGAGCAATATGCTGGTAACAACACCGGCAACGACAAGATTCTTGAAACTGCCTTCAAAAAGGAAACAATTGGGCTTGTCACAAGGGAGCAGTATGTTGAAAATAGGGTTAACATTCGAACCAaaattgaagaagaagaaaaagagaaaCTTCAAAAGCTACAACAAGAGGAAGAGGAGCTTCAGTtacaaaaactaaaaaatagGAAAGTCAAAGCAAACCCAAAGCTATCTTTTTC...

CDS

Download CDS FASTA

1020 bp · LXL04_022358|LXL04_022358|OH1004|CDS

ATGGAGACGCAAGCAGGTCGAACGGAGCAATATGCTGGTAACAACACCGGCAACGACAAGATTCTTGAAACTGCCTTCAAAAAGGAAACAATTGGGCTTGTCACAAGGGAGCAGTATGTTGAAAATAGGGTTAACATTCGAACCAAAATTGAAGAAGAAGAAAAAGAGAAACTTCAAAAGCTACAACAAGAGGAAGAGGAGCTTCAGTTACAAAAACTAAAAAATAGGAAAGTCAAAGCAAACCCAAAGCTATCTTTTTC...

Protein

Download Protein FASTA

339 aa · LXL04_022358|LXL04_022358|OH1004|PROTEIN

METQAGRTEQYAGNNTGNDKILETAFKKETIGLVTREQYVENRVNIRTKIEEEEKEKLQKLQQEEEELQLQKLKNRKVKANPKLSFSEDIENGEEEEEEDGEDKNKESNMFGRRGFGKDPTVETSFLPDSEREAEEQAERERLRKQWLREQEQIKNEALEITYSYWDGAGHRRVMQVRKGDTIGEFLRSVQQQLAPEFREIRTTSVENLLYVKEDLIIPHELELSEASCEEDNTRSNSSQFGQKQPDPPQLSWKLIKTNM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022358`
TK1151 ID	TkA05G462780
OH-1004 ID	LXL04_022358
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.800
Protein coverage (%)	TK1151 87.346 / OH-1004 90.265 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022358

Location Chr04:149093988-149096949 (+)

Description Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21150`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0535300`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`UniProt: B8BDW1`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022358 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0009637 response to blue light Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0035196 miRNA processing Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0048511 rhythmic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0030496 midbody Cellular Component

GO:0045171 intercellular bridge Cellular Component

KEGG gene cross-reference

ath:AT2G21150

dosa:Os09g0535300

dpo:4801527

mmu:108161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.617

Rank 1 · LXL04_022358 · OH-1004

Cytoplasm0.354

Rank 2 · LXL04_022358 · OH-1004

Mitochondrion0.056

Rank 3 · LXL04_022358 · OH-1004

Cell membrane0.043

Rank 4 · LXL04_022358 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_022358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04921.21XAP5158-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022358	`PF04921.21`	XAP5	158	231	1.5e-18	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H110`	Arabidopsis thaliana	Protein XAP5 CIRCADIAN TIMEKEEPER	73.239%	Swiss-Prot	moderate database homology
`Q69JZ7`	Oryza sativa subsp. japonica	Protein XAP5 CIRCADIAN TIMEKEEPER	74.528%	Swiss-Prot	moderate database homology
`B8BDW1`	Oryza sativa subsp. indica	Protein XAP5 CIRCADIAN TIMEKEEPER	74.528%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card