LXL04_022351 | RubberDandelionOmics

Gene overview

LXL04_022351

Reference: OH-1004 Chr: Chr04 Coordinates: 148889268-148891711 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_022351|LXL04_022351|OH1004|cDNA

aTGCGCGGATTGCAGAAATCAAAAAGGCTTTCATGGGCATCAGATTTAAATCTTTGTCAGGTGAAGCTGTTTTTATCAGATGAATCTCCTTCTCAAGTGGGATTGGGCGGTCAAGATCATCTCCAAGCAAAGGAATCTTGGCATTCAGATGACAACTTGCCACCTGGATTTGAAGGAATTCAGCCTGCAAACTTATTTCAGAATAAATTGTCTCAAATTACTCTCATTCAATGGAAATGTCCTTCTAGATTTGTTGTGGA...

CDS

Download CDS FASTA

1077 bp · LXL04_022351|LXL04_022351|OH1004|CDS

ATGCGCGGATTGCAGAAATCAAAAAGGCTTTCATGGGCATCAGATTTAAATCTTTGTCAGGTGAAGCTGTTTTTATCAGATGAATCTCCTTCTCAAGTGGGATTGGGCGGTCAAGATCATCTCCAAGCAAAGGAATCTTGGCATTCAGATGACAACTTGCCACCTGGATTTGAAGGAATTCAGCCTGCAAACTTATTTCAGAATAAATTGTCTCAAATTACTCTCATTCAATGGAAATGTCCTTCTAGATTTGTTGTGGA...

Protein

Download Protein FASTA

358 aa · LXL04_022351|LXL04_022351|OH1004|PROTEIN

MRGLQKSKRLSWASDLNLCQVKLFLSDESPSQVGLGGQDHLQAKESWHSDDNLPPGFEGIQPANLFQNKLSQITLIQWKCPSRFVVDPNWQVTAGEESKEVDLESQREMRVLEAVYPRPSAIPPNPASPIQDESYNDHLTPLIPVTPIEDDDTSSVPTTNGMPPPGIEPDVMNAAYTALTTAMSSSQGNLIDPNLLIKILSTPTLIEKLVSTHGPPSAAMLPPVTAAHVPSSTPSSSTAPHYARLGGPVHVHVPPPPPPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022351`
TK1151 ID	TkA05G461980
OH-1004 ID	LXL04_022351
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022351

Location Chr04:148889268-148891711 (+)

Description Similar to At1g19860: Zinc finger CCCH domain-containing protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19860`	Zinc finger CCCH domain-containing protein 6.	No verified direct reference in this release
`At5g66270`	Zinc finger CCCH domain-containing protein 68.	No verified direct reference in this release
`At3g51180`	Zinc finger CCCH domain-containing protein 45.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0663200`	Zinc finger CCCH domain-containing protein 30.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022351 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G19860

ath:AT3G51180

ath:AT5G66270

dosa:Os04g0663200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · LXL04_022351 · OH-1004

Cytoplasm0.185

Rank 2 · LXL04_022351 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_022351 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_022351 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_022351 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XU4`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 6	42.993%	Swiss-Prot	moderate database homology
`Q9FH61`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 68	37.327%	Swiss-Prot	moderate database homology
`Q94C33`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 45	36.179%	Swiss-Prot	moderate database homology
`Q7XM16`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 30	34.328%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card