LXL04_022343 | RubberDandelionOmics

Gene overview

LXL04_022343

Reference: OH-1004 Chr: Chr04 Coordinates: 148732649-148734198 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · LXL04_022343|LXL04_022343|OH1004|cDNA

ATGTTTAAGCGGGATAAGGGACACGTTTCAAGGTCTAATTTCTATGCCCTAGCGAGTAGCGCCTCTTCTCCCTCCCTTCATCATCACAGCTGCCCGCCACTACTCTCTTTCTTCCTCCTTGACGCCGATGACTTCTACCTCCACATCGGTGACTTCACCGGCGCTCTATATCTATGCTACCCGTCGTATTTGCCGGTGAAAGCTCCTCGATGCCGATCTCTTGAGGGATTCAATGACCACCAACGAATCGACGATGGCTT...

CDS

Download CDS FASTA

681 bp · LXL04_022343|LXL04_022343|OH1004|CDS

ATGTTTAAGCGGGATAAGGGACACGTTTCAAGGTCTAATTTCTATGCCCTAGCGAGTAGCGCCTCTTCTCCCTCCCTTCATCATCACAGCTGCCCGCCACTACTCTCTTTCTTCCTCCTTGACGCCGATGACTTCTACCTCCACATCGGTGACTTCACCGGCGCTCTATATCTATGCTACCCGTCGTATTTGCCGGTGAAAGCTCCTCGATGCCGATCTCTTGAGGGATTCAATGACCACCAACGAATCGACGATGGCTT...

Protein

Download Protein FASTA

226 aa · LXL04_022343|LXL04_022343|OH1004|PROTEIN

MFKRDKGHVSRSNFYALASSASSPSLHHHSCPPLLSFFLLDADDFYLHIGDFTGALYLCYPSYLPVKAPRCRSLEGFNDHQRIDDGFCQQHPRPHLFSFYICGSANADVKQGNDILFLAVPIAVIASFKKMKKLTIHRSLIVAALKESYLLTLSSNEKKVKRVHPFPLTEAFDPELCTVLVENLSEDHIIENMKKIFGEAGLCLITTNVKRLDESEARHQQELAQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022343`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022343

Location Chr04:148732649-148734198 (+)

Description Similar to LARP6A: La-related protein 6A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46250`	Transcriptional regulator.	No verified direct reference in this release
`At3g19090`	Transcriptional regulator.	No verified direct reference in this release
`At2g43970`	Transcriptional regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022343 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006396 RNA processing Biological Process

GO:0009846 pollen germination Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0048027 mRNA 5'-UTR binding Molecular Function

KEGG gene cross-reference

ath:AT2G43970

ath:AT3G19090

ath:AT5G46250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.471

Rank 1 · LXL04_022343 · OH-1004

Cytoplasm0.396

Rank 2 · LXL04_022343 · OH-1004

Mitochondrion0.097

Rank 3 · LXL04_022343 · OH-1004

Endoplasmic reticulum0.094

Rank 4 · LXL04_022343 · OH-1004

Cell membrane0.074

Rank 5 · LXL04_022343 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05383.24La119-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022343	`PF05383.24`	La	119	147	2.1e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A38`	Arabidopsis thaliana	La-related protein 6A	60.976%	Swiss-Prot	weak database homology
`Q9LHL3`	Arabidopsis thaliana	La-related protein 6C	42.683%	Swiss-Prot	weak database homology
`O80567`	Arabidopsis thaliana	La-related protein 6B	42.857%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card