LXL04_022341 | RubberDandelionOmics

Gene overview

LXL04_022341

Reference: OH-1004 Chr: Chr04 Coordinates: 148622103-148622519 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · LXL04_022341|LXL04_022341|OH1004|cDNA

ATGTCAGGTTGCAGCAAAATCCGCCACATTGTACAGCTCCGCCAAATGCTTCGACGGTGGAGGAAGAAGGCGGCAATGACATCCCGTAAATGCATACCTTCTGACGTCCCCGCCGGCCACGTCGCCGTCTGCGTCGGTTCTAATTGCCGGAGATTCGTCGTCCGAGCAACTTACCTTAATCACCCGGTCTTCAAGAAGCTTTTAAACCAAGCAGAAGAGGAGTTCGGGTTTTCTAACTCCGGTCCGCTCGCGATCCCTTG...

CDS

Download CDS FASTA

417 bp · LXL04_022341|LXL04_022341|OH1004|CDS

ATGTCAGGTTGCAGCAAAATCCGCCACATTGTACAGCTCCGCCAAATGCTTCGACGGTGGAGGAAGAAGGCGGCAATGACATCCCGTAAATGCATACCTTCTGACGTCCCCGCCGGCCACGTCGCCGTCTGCGTCGGTTCTAATTGCCGGAGATTCGTCGTCCGAGCAACTTACCTTAATCACCCGGTCTTCAAGAAGCTTTTAAACCAAGCAGAAGAGGAGTTCGGGTTTTCTAACTCCGGTCCGCTCGCGATCCCTTG...

Protein

Download Protein FASTA

138 aa · LXL04_022341|LXL04_022341|OH1004|PROTEIN

MSGCSKIRHIVQLRQMLRRWRKKAAMTSRKCIPSDVPAGHVAVCVGSNCRRFVVRATYLNHPVFKKLLNQAEEEFGFSNSGPLAIPCDEYLFEEIIRFLSRSGSSSTRFVNLEEFQRHCHVGIRSNIDFWPESRPLLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022341`
TK1151 ID	TkA05G461160
OH-1004 ID	LXL04_022341
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 89.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022341

Location Chr04:148622103-148622519 (-)

Description Similar to SAUR50: Auxin-responsive protein SAUR50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34760`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion (By similarity).	No verified direct reference in this release
`At1g79130`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	No verified direct reference in this release
`At2g21220`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022341 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009639 response to red or far red light Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G79130

ath:AT2G21220

ath:AT4G34760

gmx:113001050

gmx:113001959

gmx:113001961

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · LXL04_022341 · OH-1004

Nucleus0.400

Rank 2 · LXL04_022341 · OH-1004

Cell membrane0.209

Rank 3 · LXL04_022341 · OH-1004

Endoplasmic reticulum0.068

Rank 4 · LXL04_022341 · OH-1004

Plastid0.039

Rank 5 · LXL04_022341 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible12-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022341	`PF02519.21`	Auxin_inducible	12	102	2.8e-32	111.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65695`	Arabidopsis thaliana	Auxin-responsive protein SAUR50	39.806%	Swiss-Prot	moderate database homology
`O64538`	Arabidopsis thaliana	Auxin-responsive protein SAUR40	44.048%	Swiss-Prot	moderate database homology
`Q9SIG9`	Arabidopsis thaliana	Protein SMALL AUXIN UP-REGULATED RNA 12	39.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card