RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_022316
Reference: OH-1004 Chr: Chr04 Coordinates: 148047699-148051180 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3000 bp · LXL04_022316|LXL04_022316|OH1004|cDNA

ATGCCTTATTCTTCTGATCTTGAGACTATAAACACCGTACCATCACCTATCAACTTTTCTCGGCGTACTTCCATAAAAAAATCACAGATGTTGAAAATTGTTTTTCTTCACGTTTTCTTCTTCACTATTATCGAATTTTCAAatggtttttcagattttgatGCTTTAATGAAGCTCAAAGCTTCAATGGTAGCATCAAATAGCTCTGAATTAGACGACTGGAACGTTGATAACTCACATTGTTCGTTTTCTGGAGTTTC...

CDS

Download CDS FASTA

3000 bp · LXL04_022316|LXL04_022316|OH1004|CDS

ATGCCTTATTCTTCTGATCTTGAGACTATAAACACCGTACCATCACCTATCAACTTTTCTCGGCGTACTTCCATAAAAAAATCACAGATGTTGAAAATTGTTTTTCTTCACGTTTTCTTCTTCACTATTATCGAATTTTCAAATGGTTTTTCAGATTTTGATGCTTTAATGAAGCTCAAAGCTTCAATGGTAGCATCAAATAGCTCTGAATTAGACGACTGGAACGTTGATAACTCACATTGTTCGTTTTCTGGAGTTTC...

Protein

Download Protein FASTA

999 aa · LXL04_022316|LXL04_022316|OH1004|PROTEIN

MPYSSDLETINTVPSPINFSRRTSIKKSQMLKIVFLHVFFFTIIEFSNGFSDFDALMKLKASMVASNSSELDDWNVDNSHCSFSGVSCDEDFRVTSLTISYVPLFGTIPPEIGVLNKLVNLTLVSDNLTGQLPVEMSNLTSIRFINISSNIFIGELPGEIVAGMAELEAFDVYNNNLTGRLPVEIVKLKNLKILYLGGNFFSGEIPEDYSEFQSLQILGLQQNELSGRIPASLSRVSTLEQLLIGYANSYEGGIPPEFGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_022316
TK1151 IDTkA05G458180
OH-1004 IDLXL04_022316
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)98.900
Protein coverage (%)TK1151 60.349 / OH-1004 27.728
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_022316
LocationChr04:148047699-148051180 (+)
DescriptionSimilar to CLV1: Receptor protein kinase CLAVATA1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g75820 LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and BAM3, participates in the detection of CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.
Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane.2010 · DOI: 10.1104/pp.109.149930
Receptor-like cytoplasmic kinase MAZZA mediates developmental processes with CLAVATA1 family receptors in Arabidopsis.2021 · DOI: 10.1093/jxb/erab183
A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791
Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007172 signal complex assembly Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0030154 cell differentiation Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0036289 peptidyl-serine autophosphorylation Biological Process
GO:2000037 regulation of stomatal complex patterning Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016020 membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G75820
gmx:732625
gmx:732661
mtr:11439632
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.866
Rank 1 · LXL04_022316 · OH-1004
Endoplasmic reticulum0.088
Rank 2 · LXL04_022316 · OH-1004
Cytoplasm0.062
Rank 3 · LXL04_022316 · OH-1004
Nucleus0.037
Rank 4 · LXL04_022316 · OH-1004
Lysosome / Vacuole0.029
Rank 5 · LXL04_022316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_251-89 aa
PF23598.2LRR_14136-245 aa
PF13855.13LRR_8145-199 aa
PF23598.2LRR_14256-387 aa
PF13855.13LRR_8288-346 aa
PF12799.14LRR_4477-513 aa
PF13855.13LRR_8478-537 aa
PF23598.2LRR_14498-608 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_022316PF08263.18LRRNT_251895.2e-0936.9
LXL04_022316PF23598.2LRR_141362451.2e-32113.8
LXL04_022316PF13855.13LRR_81451994.8e-35119.8
LXL04_022316PF23598.2LRR_142563871.2e-32113.8
LXL04_022316PF13855.13LRR_82883464.8e-35119.8
LXL04_022316PF12799.14LRR_44775138e-33112.4
LXL04_022316PF13855.13LRR_84785374.8e-35119.8
LXL04_022316PF23598.2LRR_144986081.2e-32113.8
LXL04_022316PF13855.13LRR_85025614.8e-35119.8
LXL04_022316PF13855.13LRR_85506094.8e-35119.8
LXL04_022316PF12799.14LRR_45746088e-33112.4
LXL04_022316PF00069.32Pkinase7129802.8e-40139.1
LXL04_022316PF07714.24PK_Tyr_Ser-Thr7139829.6e-41140.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SYQ8Arabidopsis thalianaReceptor protein kinase CLAVATA161.975%Swiss-Protstrong database homology

JBrowse

View in Genome Browser