LXL04_022259 | RubberDandelionOmics

Gene overview

LXL04_022259

Reference: OH-1004 Chr: Chr04 Coordinates: 147017104-147021153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1265 bp · LXL04_022259|LXL04_022259|OH1004|cDNA

ATGTTTCAGTATTATCTTCTTAGCAGGAAGGATATCCCTCCAAGCCATGAAATTAGAGCTGTTCAGATAAATCTTGATTTGGATTCAGAAGATGAAACTCTTTGAGAAGATTCTGAAATTGCTTTGAAACAAGAATTAGCTTGGCCTTCTCATCTGTCTTTACAGGCATGTCTTCTTCCTACACCCAAGGGGCGATCTTGTGTTGTGGCTTCGGATTCCTCTGGAAAAGTctgatggtgatgatgatgtTGTCAATGGGG...

CDS

Download CDS FASTA

1125 bp · LXL04_022259|LXL04_022259|OH1004|CDS

TTGGCCTTCTCATCTGTCTTTACAGGCATGTCTTCTTCCTACACCCAAGGGGCGATCTTGTGTTGTGGCTTCGGATTCCTCTGGAAAAGTCTGATGGTGATGATGATGTTGTCAATGGGGTTACTGATCGAATGGTCTTCACTACCTTATCCAAATTCACTTGGGCGTTGGATTGGAGAGCCTATAAAATCTGCCATTCTTCATACTGATTCTTTTTTAACAAATGCACGCGGGTACCTTTGTCTATCCAAACGTCATCA...

Protein

Download Protein FASTA

374 aa · LXL04_022259|LXL04_022259|OH1004|PROTEIN

MAFSSVFTGMSSSYTQGAILCCGFGFLWKSLMVMMMLSMGLLIEWSSLPYPNSLGRWIGEPIKSAILHTDSFLTNARGYLCLSKRHQNLLSSFFYYSVQIVLSGKAVHKVAASGATQPNAQQAQRHELRSYLEPLPEQERFEPLMDNLEAQTYETFEKDGVKYIQYQRVVSKALLDRISDENASTTTVVLMVVGAGRGPLVRASLQVHNYTVWPNSPSQSRLLRKLNKQEERMCKVRDLSTIIMSDEIVDHNAAKTETVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022259`
TK1151 ID	TkA05G454030
OH-1004 ID	LXL04_022259
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 35.027 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022259

Location Chr04:147017104-147021153 (+)

Description Similar to PRMT5: Protein arginine N-methyltransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31120`	Methylates arginine residues of myelin basic protein (MBP) in vitro.	SKB1-mediated symmetric dimethylation of histone H4R3 controls flowering time in Arabidopsis.2007 · DOI: 10.1038/sj.emboj.7601647

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0139200`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release
`UniProt: A2X0Q3`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022259 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007088 regulation of mitotic nuclear division Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0018216 peptidyl-arginine methylation Biological Process

GO:0032259 methylation Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT4G31120

dosa:Os02g0139200

hsa:10419

xla:407754

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · LXL04_022259 · OH-1004

Nucleus0.294

Rank 2 · LXL04_022259 · OH-1004

Cell membrane0.259

Rank 3 · LXL04_022259 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_022259 · OH-1004

Mitochondrion0.096

Rank 5 · LXL04_022259 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17285.9PRMT5_TIM37-132 aa

PF05185.23PRMT5138-210 aa

PF00257.25Dehydrin287-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022259	`PF17285.9`	PRMT5_TIM	37	132	2.5e-18	67.0
LXL04_022259	`PF05185.23`	PRMT5	138	210	2.7e-23	83.4
LXL04_022259	`PF00257.25`	Dehydrin	287	356	3e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWT4`	Arabidopsis thaliana	Protein arginine N-methyltransferase 1.5	52.913%	Swiss-Prot	weak database homology
`Q6YXZ7`	Oryza sativa subsp. japonica	Protein arginine N-methyltransferase 5	54.808%	Swiss-Prot	weak database homology
`A2X0Q3`	Oryza sativa subsp. indica	Protein arginine N-methyltransferase 5	54.808%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card