LXL04_022120 | RubberDandelionOmics

Gene overview

LXL04_022120

Reference: OH-1004 Chr: Chr04 Coordinates: 144996300-144999587 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2283 bp · LXL04_022120|LXL04_022120|OH1004|cDNA

ATGTGGAAGCGTGGAGGTAGCTTGCACGGTGGCGGTGGTGCAGAGAAATTGCAGCTGAAGGGCAACCACATGGTGGCGGTGGCAATCGACAAGGACAAAAACAGCCAACACGCTCTCAAATGGACAATCGAACATATTCTCACACGAGGCCAGACCGTCGTCCTCATTCACGCGTTGATGCATCTTGTGCAATCAAGCAACAACAAGAGAAGCAAATCAAAGACCTGTTCCTTACCTTCCATTGCTTCTGTACCCGTAAA...

CDS

Download CDS FASTA

2283 bp · LXL04_022120|LXL04_022120|OH1004|CDS

ATGTGGAAGCGTGGAGGTAGCTTGCACGGTGGCGGTGGTGCAGAGAAATTGCAGCTGAAGGGCAACCACATGGTGGCGGTGGCAATCGACAAGGACAAAAACAGCCAACACGCTCTCAAATGGACAATCGAACATATTCTCACACGAGGCCAGACCGTCGTCCTCATTCACGCGTTGATGCATCTTGTGCAATCAAGCAACAACAAGAGAAGCAAATCAAAGACCTGTTCCTTACCTTCCATTGCTTCTGTACCCGTAAA...

Protein

Download Protein FASTA

760 aa · LXL04_022120|LXL04_022120|OH1004|PROTEIN

MWKRGGSLHGGGGAEKLQLKGNHMVAVAIDKDKNSQHALKWTIEHILTRGQTVVLIHALMHLVQSSNNKRSKSKTCSLPSIASVPVNKYAISRFFFGTLRVFELKSDLVQIQCFDVILEDTNIAKVLAEYANYAAIDFLVLGASAKHGFIRFRSSDVPSHVMKSAPDFCTVYVISKGKISSAKKSSKSAPFPSPLREKIDEQSNNILEASVRQNLEASVRRKDSFSIPRPEKTAEKPLPVPEDAELVPSPFNRGRGLNAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022120`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022120

Location Chr04:144996300-144999587 (+)

Description Similar to PUB35: U-box domain-containing protein 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25160`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g19410`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61550`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61560`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g51270`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022120 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19410

ath:AT4G25160

ath:AT5G61550

ath:AT5G61560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.586

Rank 1 · LXL04_022120 · OH-1004

Cytoplasm0.304

Rank 2 · LXL04_022120 · OH-1004

Nucleus0.249

Rank 3 · LXL04_022120 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_022120 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_022120 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00582.33Usp25-166 aa

PF00069.32Pkinase466-671 aa

PF07714.24PK_Tyr_Ser-Thr468-671 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022120	`PF00582.33`	Usp	25	166	8.6e-08	33.6
LXL04_022120	`PF00069.32`	Pkinase	466	671	1.8e-39	136.5
LXL04_022120	`PF07714.24`	PK_Tyr_Ser-Thr	468	671	1.5e-37	130.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW11`	Arabidopsis thaliana	U-box domain-containing protein 35	35.117%	Swiss-Prot	moderate database homology
`Q8S8S7`	Arabidopsis thaliana	U-box domain-containing protein 34	33.995%	Swiss-Prot	moderate database homology
`Q9FKG6`	Arabidopsis thaliana	U-box domain-containing protein 52	46.009%	Swiss-Prot	moderate database homology
`Q9FKG5`	Arabidopsis thaliana	U-box domain-containing protein 51	44.615%	Swiss-Prot	moderate database homology
`Q9LU47`	Arabidopsis thaliana	Putative U-box domain-containing protein 53	42.588%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card