LXL04_021905 | RubberDandelionOmics

Gene overview

LXL04_021905

Reference: OH-1004 Chr: Chr04 Coordinates: 139995687-139997295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_021905|LXL04_021905|OH1004|cDNA

ATGTATTTTGGGGAGGTATTGGATGTAATCTTCAAGAATCCCATGGAATGGGGAGAAGCAGTCGCACGACAGGGAGGCAGACCTGCCGGTGACGCCGATGTGTGTTTTTACAGCATTGCTACTGATCCTCCGGTGATCGGTTCTCTCGAGCTTATCCAGATCGATCCGGCTTCGTATGACCCCCACTTGACAGGCAACGACTCTTCGACTCTCGTGAATTATGGCCGGTTGACTTGTGGCTCGCACCAGTGGGGGCCAGG...

CDS

Download CDS FASTA

825 bp · LXL04_021905|LXL04_021905|OH1004|CDS

ATGTATTTTGGGGAGGTATTGGATGTAATCTTCAAGAATCCCATGGAATGGGGAGAAGCAGTCGCACGACAGGGAGGCAGACCTGCCGGTGACGCCGATGTGTGTTTTTACAGCATTGCTACTGATCCTCCGGTGATCGGTTCTCTCGAGCTTATCCAGATCGATCCGGCTTCGTATGACCCCCACTTGACAGGCAACGACTCTTCGACTCTCGTGAATTATGGCCGGTTGACTTGTGGCTCGCACCAGTGGGGGCCAGG...

Protein

Download Protein FASTA

274 aa · LXL04_021905|LXL04_021905|OH1004|PROTEIN

MYFGEVLDVIFKNPMEWGEAVARQGGRPAGDADVCFYSIATDPPVIGSLELIQIDPASYDPHLTGNDSSTLVNYGRLTCGSHQWGPGFSNDTDVFGRAWQSDAKFRSANSIGIKSVTAVRNVINTGTSPNYIPAKLYDSAVTLTGKGNLEYELPVDAKLDYLIWLHFAEIDVSVNQKGKRVFDVIINDENVTRIDIFKEVGGFAAYSYHYVANVIGSPLLFGLENYAIVPADVMTVPEQASAMQALKESLRVPERMGWNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021905`
TK1151 ID	TkA05G435580
OH-1004 ID	LXL04_021905
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 49.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021905

Location Chr04:139995687-139997295 (-)

Description Similar to RLP4: Receptor-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28340`	Receptor-like protein 4.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At1g51860`	Probable LRR receptor-like serine/threonine-protein kinase At1g51860.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At1g51880`	Probable LRR receptor-like serine/threonine-protein kinase At1g51880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

KEGG gene cross-reference

ath:AT1G28340

ath:AT1G51860

ath:AT1G51880

ath:AT3G51550

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.451

Rank 1 · LXL04_021905 · OH-1004

Lysosome / Vacuole0.192

Rank 2 · LXL04_021905 · OH-1004

Cytoplasm0.120

Rank 3 · LXL04_021905 · OH-1004

Endoplasmic reticulum0.112

Rank 4 · LXL04_021905 · OH-1004

Cell membrane0.080

Rank 5 · LXL04_021905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like31-213 aa

PF11721.15Malectin92-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021905	`PF12819.14`	Malectin_like	31	213	7.3e-28	98.5
LXL04_021905	`PF11721.15`	Malectin	92	212	2.1e-14	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HWL3`	Arabidopsis thaliana	Receptor-like protein 4	35.019%	Swiss-Prot	moderate database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	28.846%	Swiss-Prot	weak database homology
`C0LGG4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g51860	23.574%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	30.147%	Swiss-Prot	weak database homology
`Q9FZB1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g51880	24.806%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card