Gene Card
Gene overview
cDNA / CDS / Protein Sequences
798 bp · LXL04_021902|LXL04_021902|OH1004|cDNA
ATGGCGGATTCGACCTACACCAGTCTTCCCGCTAGTCAATTGGCTGGTTCGGTTCCGGCTGTCATAACAGAAGGAAAAGCTCCAGTTATACAACAGGATCCCGAAGCAAACCTACAAATCTTCCCTCCTGGTGGTGGTCGTGGTTACCAGACTCTCACAAGTTCAAGTGATGGAGGTGGACAACAATCTACCAACAACTGGAATGGAGCATTCAACATCTCATCATACACACAATACTTCAATGTTGATACAGACGATGT...
798 bp · LXL04_021902|LXL04_021902|OH1004|CDS
ATGGCGGATTCGACCTACACCAGTCTTCCCGCTAGTCAATTGGCTGGTTCGGTTCCGGCTGTCATAACAGAAGGAAAAGCTCCAGTTATACAACAGGATCCCGAAGCAAACCTACAAATCTTCCCTCCTGGTGGTGGTCGTGGTTACCAGACTCTCACAAGTTCAAGTGATGGAGGTGGACAACAATCTACCAACAACTGGAATGGAGCATTCAACATCTCATCATACACACAATACTTCAATGTTGATACAGACGATGT...
Protein
Download Protein FASTA265 aa · LXL04_021902|LXL04_021902|OH1004|PROTEIN
MADSTYTSLPASQLAGSVPAVITEGKAPVIQQDPEANLQIFPPGGGRGYQTLTSSSDGGGQQSTNNWNGAFNISSYTQYFNVDTDDVVNRLTSSLYPTGDFFRKIEANPDLYGLIWIATTLVFVIASVGNLATYLMSKKSDSTASWSFDVSYFQVSAIAVYSYVFLVPLGFYLLLQYFGSKVALVHLWCMWGYSLFIFILSSIFLVIPVDFVRWSITIITGITSAAFVGLNLRSHVELNELTIVLVAACFMQFALAIFIK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021902 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021902 |
|---|---|
| Location | Chr04:139890250-139892024 (+) |
| Description | Similar to yipf1: Protein YIPF1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0016192 vesicle-mediated transport Biological Process GO:0000138 Golgi trans cisterna Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005797 Golgi medial cisterna Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030133 transport vesicle Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0031267 small GTPase binding Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0281587 hsa:54432 mmu:230584 pon:100172394 rno:298312 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04893.23Yip197-258 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021902 | PF04893.23 | Yip1 | 97 | 258 | 1.8e-14 | 54.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.