LXL04_021834 | RubberDandelionOmics

Gene overview

LXL04_021834

Reference: OH-1004 Chr: Chr04 Coordinates: 138245122-138249666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · LXL04_021834|LXL04_021834|OH1004|cDNA

atgtgttataaaggctcctataaaaaaaatttaaaaaaatttcgtAAAAACTTCAGATATTATACTCTAAATTATAACAAAACGGCTATGAAGCCACCTCCCAcgtcttcttcttcatcatcttcaatcTCAGCATCTAATCTTATAAGGAAAAGTCGACTTTCTCCATACCTTTTCACATTGCTAGCCTTCATCCTCTTCGTCACCTTCTTATATGGTCAAGACCTCGGTTGCATCATCGGTCAACTTGATATTGATAT...

CDS

Download CDS FASTA

1377 bp · LXL04_021834|LXL04_021834|OH1004|CDS

ATGTGTTATAAAGGCTCCTATAAAAAAAATTTAAAAAAATTTCGTAAAAACTTCAGATATTATACTCTAAATTATAACAAAACGGCTATGAAGCCACCTCCCACGTCTTCTTCTTCATCATCTTCAATCTCAGCATCTAATCTTATAAGGAAAAGTCGACTTTCTCCATACCTTTTCACATTGCTAGCCTTCATCCTCTTCGTCACCTTCTTATATGGTCAAGACCTCGGTTGCATCATCGGTCAACTTGATATTGATAT...

Protein

Download Protein FASTA

458 aa · LXL04_021834|LXL04_021834|OH1004|PROTEIN

MCYKGSYKKNLKKFRKNFRYYTLNYNKTAMKPPPTSSSSSSSISASNLIRKSRLSPYLFTLLAFILFVTFLYGQDLGCIIGQLDIDISPNPPPPYTAKKYEKLPFSIGETEKGCDYFSGKWVWDPLNRPLYQESECPYIQPQLTCQEHGRPDRDYQFWRWQPHGCSLPSFNASLMLDTLRNKRMMFVGDSLNRGQYVSMVCLLHSLIPDNAKSMETFGSLTVFTAKDYNATIEFYWAPFLLESNSDDAIIHRVSDRVVRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021834`
TK1151 ID	TkA05G428060
OH-1004 ID	LXL04_021834
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 93.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021834

Location Chr04:138245122-138249666 (-)

Description Similar to TBL33: Protein trichome birefringence-like 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40320`	Probable xylan acetyltransferase that plays a role in xylan acetylation and normal deposition of secondary cell walls.	Mutations of Arabidopsis TBL32 and TBL33 Affect Xylan Acetylation and Secondary Wall Deposition.2016 · DOI: 10.1371/journal.pone.0146460
`At3g11030`	Probable xylan acetyltransferase that plays a role in xylan acetylation and normal deposition of secondary cell walls.	Mutations of Arabidopsis TBL32 and TBL33 Affect Xylan Acetylation and Secondary Wall Deposition.2016 · DOI: 10.1371/journal.pone.0146460

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0817900`	Probable xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	No verified direct reference in this release
`Os05g0356700`	Probable xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	No verified direct reference in this release
`Os03g0817800`	Probable xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021834 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

GO:1990538 xylan O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G40320

ath:AT3G11030

dosa:Os03g0817800

dosa:Os03g0817900

dosa:Os05g0356700

osa:4338521

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.533

Rank 1 · LXL04_021834 · OH-1004

Cell membrane0.093

Rank 2 · LXL04_021834 · OH-1004

Endoplasmic reticulum0.070

Rank 3 · LXL04_021834 · OH-1004

Extracellular0.065

Rank 4 · LXL04_021834 · OH-1004

Lysosome / Vacuole0.037

Rank 5 · LXL04_021834 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N113-166 aa

PF13839.13PC-Esterase167-453 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021834	`PF14416.12`	PMR5N	113	166	1.2e-22	80.7
LXL04_021834	`PF13839.13`	PC-Esterase	167	453	1.3e-88	298.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IH21`	Arabidopsis thaliana	Protein trichome birefringence-like 33	77.017%	Swiss-Prot	strong database homology
`Q9SRL3`	Arabidopsis thaliana	Protein trichome birefringence-like 32	61.364%	Swiss-Prot	strong database homology
`Q84TW8`	Oryza sativa subsp. japonica	Probable xylan O-acetyltransferase 10	58.645%	Swiss-Prot	strong database homology
`Q5W6Y3`	Oryza sativa subsp. japonica	Probable xylan O-acetyltransferase 9	63.277%	Swiss-Prot	strong database homology
`Q10BH4`	Oryza sativa subsp. japonica	Probable xylan O-acetyltransferase 11	51.639%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card