LXL04_021811 | RubberDandelionOmics

Gene overview

LXL04_021811

Reference: OH-1004 Chr: Chr04 Coordinates: 137468548-137473627 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2367 bp · LXL04_021811|LXL04_021811|OH1004|cDNA

ATGGATCTTGGCCGCCAAAAGTGTTGGGGAAATTCCAAGGATTCTTGGAGGACAACATTGGTGTTAGCTTATCAAAGTCTTGGTGTTGTGTATGGTGACCTCAGCATTTCTCCAATTTATGTCTACAAAAGCACTTTTGCTTCAGATATTCATCATTCGGAAACAAATGAAgagatttttggtgttcttTCATTTGTTTTTTGGACTTTAACTCTTGTTCCTTTGTTCAAATACGTCTTCATTGTTCTTCGAGCTGACGA...

CDS

Download CDS FASTA

2367 bp · LXL04_021811|LXL04_021811|OH1004|CDS

ATGGATCTTGGCCGCCAAAAGTGTTGGGGAAATTCCAAGGATTCTTGGAGGACAACATTGGTGTTAGCTTATCAAAGTCTTGGTGTTGTGTATGGTGACCTCAGCATTTCTCCAATTTATGTCTACAAAAGCACTTTTGCTTCAGATATTCATCATTCGGAAACAAATGAAGAGATTTTTGGTGTTCTTTCATTTGTTTTTTGGACTTTAACTCTTGTTCCTTTGTTCAAATACGTCTTCATTGTTCTTCGAGCTGACGA...

Protein

Download Protein FASTA

788 aa · LXL04_021811|LXL04_021811|OH1004|PROTEIN

MDLGRQKCWGNSKDSWRTTLVLAYQSLGVVYGDLSISPIYVYKSTFASDIHHSETNEEIFGVLSFVFWTLTLVPLFKYVFIVLRADDNGEGGTFALYSSICRHAKVSLLPNQQTADESLSTYKLKQPSESEKSNRSKVKMLLEKHKSLHTALLILVLLGTCMVIGDGLLTPAISVFSAVSGLELSMSKAHHEYAVIPITCFILVCLFALQHYGTHRVGFFFAPIVLLWLLCISGLGLYNIFHWNPYVYKALSPYYMYKFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021811`
TK1151 ID	TkA05G425000
OH-1004 ID	LXL04_021811
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 67.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021811

Location Chr04:137468548-137473627 (+)

Description Similar to POT2: Potassium transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40540`	Low-affinity potassium transporter.	A mutation in the Arabidopsis KT2/KUP2 potassium transporter gene affects shoot cell expansion.2002 · DOI: 10.1105/tpc.010322
`At1g70300`	Probable potassium transporter.	No verified direct reference in this release
`At5g14880`	Probable potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0679000`	High-affinity potassium transporter.	No verified direct reference in this release
`Os03g0337500`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021811 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G70300

ath:AT2G40540

ath:AT5G14880

dosa:Os07g0679000

osa:9271735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.480

Rank 1 · LXL04_021811 · OH-1004

Lysosome / Vacuole0.310

Rank 2 · LXL04_021811 · OH-1004

Cytoplasm0.124

Rank 3 · LXL04_021811 · OH-1004

Endoplasmic reticulum0.104

Rank 4 · LXL04_021811 · OH-1004

Golgi apparatus0.087

Rank 5 · LXL04_021811 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705.23K_trans21-498 aa

PF22776.1K_trans_C528-786 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021811	`PF02705.23`	K_trans	21	498	2.4e-166	554.5
LXL04_021811	`PF22776.1`	K_trans_C	528	786	1.5e-30	106.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22881`	Arabidopsis thaliana	Potassium transporter 2	77.000%	Swiss-Prot	strong database homology
`Q8W4I4`	Arabidopsis thaliana	Potassium transporter 6	63.508%	Swiss-Prot	strong database homology
`Q9M7J9`	Arabidopsis thaliana	Potassium transporter 8	62.846%	Swiss-Prot	strong database homology
`Q7XIV8`	Oryza sativa subsp. japonica	Probable potassium transporter 9	72.152%	Swiss-Prot	strong database homology
`Q8VXB5`	Oryza sativa subsp. japonica	Putative potassium transporter 8	71.283%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card