LXL04_021790 | RubberDandelionOmics

Gene overview

LXL04_021790

Reference: OH-1004 Chr: Chr04 Coordinates: 137015433-137017456 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1905 bp · LXL04_021790|LXL04_021790|OH1004|cDNA

ATGGTTGATGATCTCGCATGGATTTCTGGCCTTTCATCACTTGTGCATCTCGACTTGTGTAAAGTAGATCTTGGTGAAACACGAAATAAGGACACAATGTTTTACATGATTCCTTCGTTACAAGTGTTAAGTTTGTCTGGTTGTAGACTTTCCAATGCTGATATTGGTTCTTTTCTTAATTCGAGTGGAATACTTCCCAACATTAAACGCTTGGATCTTGGATTCAATTCTTTCGAACGTCCACTCCCCGACGTTTTTCA...

CDS

Download CDS FASTA

1905 bp · LXL04_021790|LXL04_021790|OH1004|CDS

ATGGTTGATGATCTCGCATGGATTTCTGGCCTTTCATCACTTGTGCATCTCGACTTGTGTAAAGTAGATCTTGGTGAAACACGAAATAAGGACACAATGTTTTACATGATTCCTTCGTTACAAGTGTTAAGTTTGTCTGGTTGTAGACTTTCCAATGCTGATATTGGTTCTTTTCTTAATTCGAGTGGAATACTTCCCAACATTAAACGCTTGGATCTTGGATTCAATTCTTTCGAACGTCCACTCCCCGACGTTTTTCA...

Protein

Download Protein FASTA

634 aa · LXL04_021790|LXL04_021790|OH1004|PROTEIN

MVDDLAWISGLSSLVHLDLCKVDLGETRNKDTMFYMIPSLQVLSLSGCRLSNADIGSFLNSSGILPNIKRLDLGFNSFERPLPDVFQNLSSLTSLDLSHFDLSLAWNFANLLSMIPLLSKLHLSECGLDKTHLSSSRLNFSTLSNIQCLGLNRNSIGGTFPSVLTNMSSLRFLDLSYNMLNSSVPSMPNLLDLDLFDNQFKQIGDVGIWRQCHLERLDVSYNYFEKYVTDSPNYVSECSHYALEWLDLSECLNCTIPIPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021790`
TK1151 ID	TkA05G422640
OH-1004 ID	LXL04_021790
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.100
Protein coverage (%)	TK1151 100.000 / OH-1004 42.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021790

Location Chr04:137015433-137017456 (-)

Description Similar to EIX1: Receptor-like protein EIX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021790 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.795

Rank 1 · LXL04_021790 · OH-1004

Endoplasmic reticulum0.108

Rank 2 · LXL04_021790 · OH-1004

Nucleus0.071

Rank 3 · LXL04_021790 · OH-1004

Cytoplasm0.068

Rank 4 · LXL04_021790 · OH-1004

Extracellular0.028

Rank 5 · LXL04_021790 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_838-99 aa

PF12799.14LRR_438-76 aa

PF13855.13LRR_8118-180 aa

PF23598.2LRR_14241-340 aa

PF13855.13LRR_8261-300 aa

PF12799.14LRR_4265-302 aa

PF13855.13LRR_8537-594 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021790	`PF13855.13`	LRR_8	38	99	7.6e-39	132.0
LXL04_021790	`PF12799.14`	LRR_4	38	76	2.8e-20	72.6
LXL04_021790	`PF13855.13`	LRR_8	118	180	7.6e-39	132.0
LXL04_021790	`PF23598.2`	LRR_14	241	340	3.6e-15	56.3
LXL04_021790	`PF13855.13`	LRR_8	261	300	7.6e-39	132.0
LXL04_021790	`PF12799.14`	LRR_4	265	302	2.8e-20	72.6
LXL04_021790	`PF13855.13`	LRR_8	537	594	7.6e-39	132.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	27.988%	Swiss-Prot	weak database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	27.943%	Swiss-Prot	weak database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	28.697%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card