LXL04_021786 | RubberDandelionOmics

Gene overview

LXL04_021786

Reference: OH-1004 Chr: Chr04 Coordinates: 136963992-136967745 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · LXL04_021786|LXL04_021786|OH1004|cDNA

atggCGGTTGTGGGTTCGGTTCACGGTGGTTCCCTCCACTCCAAATTCCAAACCCTACCGCCGGTGGCCAGAATCTTCAACAGCCAAAAAAGATCAACCCACCATCGCCGGCCACCAAGTCCCCCAATTTTTATATCCACGAATCTCTCAGACGTAAACCCAATTCACTTGCGAGACCTTTATAGCTCCTGCAACCAGTCCTGCCACCGTTTCCCTAACATCTCCTCCGATGGACGAGTGGAGCCGGTCGACGTCGAGAA...

CDS

Download CDS FASTA

1548 bp · LXL04_021786|LXL04_021786|OH1004|CDS

ATGGCGGTTGTGGGTTCGGTTCACGGTGGTTCCCTCCACTCCAAATTCCAAACCCTACCGCCGGTGGCCAGAATCTTCAACAGCCAAAAAAGATCAACCCACCATCGCCGGCCACCAAGTCCCCCAATTTTTATATCCACGAATCTCTCAGACGTAAACCCAATTCACTTGCGAGACCTTTATAGCTCCTGCAACCAGTCCTGCCACCGTTTCCCTAACATCTCCTCCGATGGACGAGTGGAGCCGGTCGACGTCGAGAA...

Protein

Download Protein FASTA

515 aa · LXL04_021786|LXL04_021786|OH1004|PROTEIN

MAVVGSVHGGSLHSKFQTLPPVARIFNSQKRSTHHRRPPSPPIFISTNLSDVNPIHLRDLYSSCNQSCHRFPNISSDGRVEPVDVEKLTIALSHSSVVVSVFARPETVASLPENLNTGGDWYRRMIPLTPFSGKLVGFGRAVSDNGLTASIYDVMVIPSLQGRGIGHMILQRIIRLLTNKGIYDIAALCSAQEMDFFKACGFGDDMLGSTTMMYTRSGNQMVKSAEICLISARGLTRTSSLWKLQWFAVGWIDPDNKYCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021786`
TK1151 ID	TkA05G421000
OH-1004 ID	LXL04_021786
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021786

Location Chr04:136963992-136967745 (+)

Description Similar to ycf52: Uncharacterized N-acetyltransferase ycf52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19985`	Protein acetyltransferase with dual specificity triggering both N-alpha-acetylation (NTA) and epsilon-lysine acetylation (KA), possibly with a low efficiency or toward specific plastid substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y5T7`	Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021786 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010555 response to mannitol Biological Process

GO:0018394 peptidyl-lysine acetylation Biological Process

GO:0030187 melatonin biosynthetic process Biological Process

GO:0042428 serotonin metabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT4G19985

syn:sll0286

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.587

Rank 1 · LXL04_021786 · OH-1004

Nucleus0.187

Rank 2 · LXL04_021786 · OH-1004

Cytoplasm0.145

Rank 3 · LXL04_021786 · OH-1004

Cell membrane0.087

Rank 4 · LXL04_021786 · OH-1004

Mitochondrion0.082

Rank 5 · LXL04_021786 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_1129-202 aa

PF13508.14Acetyltransf_7133-202 aa

PF00168.37C2226-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021786	`PF00583.32`	Acetyltransf_1	129	202	8.2e-10	39.7
LXL04_021786	`PF13508.14`	Acetyltransf_7	133	202	5.1e-07	30.7
LXL04_021786	`PF00168.37`	C2	226	324	2.3e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940H2`	Arabidopsis thaliana	GCN5-related N-acetyltransferase 3, chloroplastic	50.000%	Swiss-Prot	weak database homology
`A2Y5T7`	Oryza sativa subsp. indica	Serotonin N-acetyltransferase 1, chloroplastic	37.037%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card