LXL04_021749 | RubberDandelionOmics

Gene overview

LXL04_021749

Reference: OH-1004 Chr: Chr04 Coordinates: 136263667-136275303 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6372 bp · LXL04_021749|LXL04_021749|OH1004|cDNA

ATGGCGACGTCAATCGCCTCACAGCTGCAGGCAATCAGGTCAATTGTTAAGGCCGATACAGACCCTGTTAAAAGGCCGTTTACCCGTCCCTCCATCTTGTTTGACGCCAAAAAAGCAGCTGATACCGACCTCGATACTCTCTTTGACCTCGCCGTTTCAGGGTTGGAGGGTCTTGTGAGTCTGGATGAAAGATTTGGGAACTACAGGAATGATTTGTTCTCTCATAAGAGTAGAGAGCTGGATAGAGAGCTGTTGGGCGT...

CDS

Download CDS FASTA

6372 bp · LXL04_021749|LXL04_021749|OH1004|CDS

ATGGCGACGTCAATCGCCTCACAGCTGCAGGCAATCAGGTCAATTGTTAAGGCCGATACAGACCCTGTTAAAAGGCCGTTTACCCGTCCCTCCATCTTGTTTGACGCCAAAAAAGCAGCTGATACCGACCTCGATACTCTCTTTGACCTCGCCGTTTCAGGGTTGGAGGGTCTTGTGAGTCTGGATGAAAGATTTGGGAACTACAGGAATGATTTGTTCTCTCATAAGAGTAGAGAGCTGGATAGAGAGCTGTTGGGCGT...

Protein

Download Protein FASTA

2123 aa · LXL04_021749|LXL04_021749|OH1004|PROTEIN

MATSIASQLQAIRSIVKADTDPVKRPFTRPSILFDAKKAADTDLDTLFDLAVSGLEGLVSLDERFGNYRNDLFSHKSRELDRELLGVEENNHINASISSYLRLLSGHFESLSALKTLEYLIRRYKIHVYNIEELVLCALPYHDTPLFVRIVQLIDTGNGKWKFLEGVKTSGAPPPRKVIVHQCMRDMGVLEALCNYAIPTKKFQASRPVISFCTAVVIEVLGSLAVIETDVVKRVLPYVISGLQTHSKGNIDHKAGALMI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021749`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021749

Location Chr04:136263667-136275303 (-)

Description Similar to At3g06530: Uncharacterized protein At3g06530

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06530`	Involved in nucleolar processing of pre-18S ribosomal RNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021749 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0016072 rRNA metabolic process Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0043487 regulation of RNA stability Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0061351 neural precursor cell proliferation Biological Process

GO:1902570 protein localization to nucleolus Biological Process

GO:2000234 positive regulation of rRNA processing Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0001650 fibrillar center Cellular Component

KEGG gene cross-reference

ath:AT3G06530

dre:334446

hsa:55127

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.814

Rank 1 · LXL04_021749 · OH-1004

Cytoplasm0.197

Rank 2 · LXL04_021749 · OH-1004

Golgi apparatus0.043

Rank 3 · LXL04_021749 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_021749 · OH-1004

Cell membrane0.031

Rank 5 · LXL04_021749 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12397.14U3snoRNP10231-356 aa

PF24477.3ARM_At3g06530630-825 aa

PF23243.2HEAT_HEATR11357-1530 aa

PF08146.18BP28CT1814-1980 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021749	`PF12397.14`	U3snoRNP10	231	356	3e-22	79.9
LXL04_021749	`PF24477.3`	ARM_At3g06530	630	825	1.2e-69	234.5
LXL04_021749	`PF23243.2`	HEAT_HEATR1	1357	1530	4.6e-44	151.4
LXL04_021749	`PF08146.18`	BP28CT	1814	1980	1.8e-33	116.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8Z4`	Arabidopsis thaliana	Uncharacterized protein At3g06530	45.365%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card