LXL04_021717 | RubberDandelionOmics

Gene overview

LXL04_021717

Reference: OH-1004 Chr: Chr04 Coordinates: 135828110-135836435 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · LXL04_021717|LXL04_021717|OH1004|cDNA

ATGATGACCTCGCTAATCCGTAGAGCGGCGTCAAGCCTAAGCTCCAACTCCAAAAGCCGTCACTTTTTTGCACCTGCAACGCGTCGTATGGAGGAGACTGGTTTATATGGATGCAATCATCTGAAAACCCCCAAGGGCTTCCAGCGTTTTGTAGATGAAGCCATTGAAAGGTCGAATGAACTTATTGGCTCCATTTCTAGAATGCCTTCCTCTGCTGAAATTATCAACGCCATGGATGAAATATCAAACACCGTATGCCA...

CDS

Download CDS FASTA

2118 bp · LXL04_021717|LXL04_021717|OH1004|CDS

ATGATGACCTCGCTAATCCGTAGAGCGGCGTCAAGCCTAAGCTCCAACTCCAAAAGCCGTCACTTTTTTGCACCTGCAACGCGTCGTATGGAGGAGACTGGTTTATATGGATGCAATCATCTGAAAACCCCCAAGGGCTTCCAGCGTTTTGTAGATGAAGCCATTGAAAGGTCGAATGAACTTATTGGCTCCATTTCTAGAATGCCTTCCTCTGCTGAAATTATCAACGCCATGGATGAAATATCAAACACCGTATGCCA...

Protein

Download Protein FASTA

705 aa · LXL04_021717|LXL04_021717|OH1004|PROTEIN

MMTSLIRRAASSLSSNSKSRHFFAPATRRMEETGLYGCNHLKTPKGFQRFVDEAIERSNELIGSISRMPSSAEIINAMDEISNTVCQVVDSAELCRHTHPDREFVDEALKASMRINEYLHYLNTNLNLYNAVLKADQDQTLTNNEAKRVAHDLRIDFEKGGIHLSAEKKHRVSQLNIEIAKCCAQYNENIAKDPGHVDVYPASRIPKNLHPLMKPINRSTAQGQKVNIREKGFRIVTEPSTVSSVLQWAHDDEVRKMTYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021717`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021717

Location Chr04:135828110-135836435 (-)

Description Similar to OCT1: Mitochondrial intermediate peptidase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51540`	Aminopeptidase which cleaves preproteins, imported into the mitochondrion, to their mature size.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021717 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006518 peptide metabolic process Biological Process

GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process

GO:0016485 protein processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004177 aminopeptidase activity Molecular Function

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G51540

hsa:4285

mmu:70478

pon:100171586

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.833

Rank 1 · LXL04_021717 · OH-1004

Cytoplasm0.119

Rank 2 · LXL04_021717 · OH-1004

Nucleus0.064

Rank 3 · LXL04_021717 · OH-1004

Plastid0.039

Rank 4 · LXL04_021717 · OH-1004

Peroxisome0.021

Rank 5 · LXL04_021717 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01432.27Peptidase_M3247-674 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021717	`PF01432.27`	Peptidase_M3	247	674	5.6e-112	376.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KDA5`	Arabidopsis thaliana	Mitochondrial intermediate peptidase, mitochondrial	65.441%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card