LXL04_021669 | RubberDandelionOmics

Gene overview

LXL04_021669

Reference: OH-1004 Chr: Chr04 Coordinates: 134584784-134594133 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2421 bp · LXL04_021669|LXL04_021669|OH1004|cDNA

ATGTTAAACGCAAATGAAAATGGGTTGAACATGGATACAAGTTTACAAAGCACAAGACACTGGTATATTGTTGTGAACGTAGATGAAAATATGTTGAACGTGGATGGAAGACTGTTGAGCGCGGATGAAGAGCTCCTATCTACCAAGCTTGGCACAATACCAAATAAAATTTCCGACTCCTTACCCAAATGCCAAAGTTGTTCAAAGACCATGGTTCCTCTGCCGATGGAACGGAGCGGCGGAGAGACCACGGCCGCAGA...

CDS

Download CDS FASTA

2421 bp · LXL04_021669|LXL04_021669|OH1004|CDS

ATGTTAAACGCAAATGAAAATGGGTTGAACATGGATACAAGTTTACAAAGCACAAGACACTGGTATATTGTTGTGAACGTAGATGAAAATATGTTGAACGTGGATGGAAGACTGTTGAGCGCGGATGAAGAGCTCCTATCTACCAAGCTTGGCACAATACCAAATAAAATTTCCGACTCCTTACCCAAATGCCAAAGTTGTTCAAAGACCATGGTTCCTCTGCCGATGGAACGGAGCGGCGGAGAGACCACGGCCGCAGA...

Protein

Download Protein FASTA

806 aa · LXL04_021669|LXL04_021669|OH1004|PROTEIN

MLNANENGLNMDTSLQSTRHWYIVVNVDENMLNVDGRLLSADEELLSTKLGTIPNKISDSLPKCQSCSKTMVPLPMERSGGETTAADTTARSLPTPFLTKTYQLVDDKTIDDVISWNEDGSSFVVWNPIEFAKDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFSNDYFRRGEKRLLCEIQRRKIASAAPAPPVAATPVATVAALSPTPRRAVSPSNSSEEQVLSSNSSRGATTNLSREPPACGGTNAELIDENERL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021669`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021669

Location Chr04:134584784-134594133 (+)

Description Similar to HSFB2A: Heat stress transcription factor B-2a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62020`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At4g11660`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0526600`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os08g0546800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021669 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G11660

ath:AT5G62020

dosa:Os08g0546800

dosa:Os09g0526600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.814

Rank 1 · LXL04_021669 · OH-1004

Cytoplasm0.197

Rank 2 · LXL04_021669 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_021669 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_021669 · OH-1004

Mitochondrion0.021

Rank 5 · LXL04_021669 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447.24HSF_DNA-bind97-186 aa

PF14223.15Retrotran_gag_2489-629 aa

PF00098.29zf-CCHC769-785 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021669	`PF00447.24`	HSF_DNA-bind	97	186	1.9e-31	109.3
LXL04_021669	`PF14223.15`	Retrotran_gag_2	489	629	3.3e-16	60.2
LXL04_021669	`PF00098.29`	zf-CCHC	769	785	5.1e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCW4`	Arabidopsis thaliana	Heat stress transcription factor B-2a	53.103%	Swiss-Prot	weak database homology
`Q9T0D3`	Arabidopsis thaliana	Heat stress transcription factor B-2b	48.148%	Swiss-Prot	weak database homology
`Q652B0`	Oryza sativa subsp. japonica	Heat stress transcription factor B-2c	50.658%	Swiss-Prot	weak database homology
`Q6Z9C8`	Oryza sativa subsp. japonica	Heat stress transcription factor B-2b	51.701%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card