LXL04_021652 | RubberDandelionOmics

Gene overview

LXL04_021652

Reference: OH-1004 Chr: Chr04 Coordinates: 134265625-134271265 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2547 bp · LXL04_021652|LXL04_021652|OH1004|cDNA

ATGCCTTCATGGTGGAATAGGCCATCATCAAAAGAATCAAAGAAGAAGACAACAAGCAAGGATAGTTTCATAGACACAATTCGCAAGTTTAGAATCTCCTCTGACAAAAAATCATCTGGTTCACGTAGAAATTGCAGTGATACAGTTTCAGAGATCGGGTCTCTATCTAGGATTCAATCCAGATCCGTTTCACcttctaaagaatccaaactTGTGGCAAGATGTCAAAGTTTTCAGGAAAGACCTCAAGCTCAACCACT...

CDS

Download CDS FASTA

2547 bp · LXL04_021652|LXL04_021652|OH1004|CDS

ATGCCTTCATGGTGGAATAGGCCATCATCAAAAGAATCAAAGAAGAAGACAACAAGCAAGGATAGTTTCATAGACACAATTCGCAAGTTTAGAATCTCCTCTGACAAAAAATCATCTGGTTCACGTAGAAATTGCAGTGATACAGTTTCAGAGATCGGGTCTCTATCTAGGATTCAATCCAGATCCGTTTCACCTTCTAAAGAATCCAAACTTGTGGCAAGATGTCAAAGTTTTCAGGAAAGACCTCAAGCTCAACCACT...

Protein

Download Protein FASTA

848 aa · LXL04_021652|LXL04_021652|OH1004|PROTEIN

MPSWWNRPSSKESKKKTTSKDSFIDTIRKFRISSDKKSSGSRRNCSDTVSEIGSLSRIQSRSVSPSKESKLVARCQSFQERPQAQPLPLPVLHPSRMTRTESGLSVSKPKHEKGSKTPPFLPLPKTRPDAADFDGADSVFSECYTDSDDPPDSSQLSPLASDYDTGSRTTAGSPSNMLIKDHIPITKRELLPKPHDTHTSSSSPSRPKPLRNHVPNLHIPSHGSFFSAPDSSISSPSRSPLRAFNPEQVLTSAFYTSKPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021652`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021652

Location Chr04:134265625-134271265 (-)

Description Similar to YDA: Mitogen-activated protein kinase kinase kinase YODA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63700`	Functions in a MAP kinase cascade that acts as a molecular switch to regulate the first cell fate decisions in the zygote and the early embryo.	No verified direct reference in this release
`At1g53570`	Mitogen-activated protein kinase kinase kinase 3.	No verified direct reference in this release
`At5g66850`	Mitogen-activated protein kinase (MAPK) involved in the transduction of signal between the host cell surface chitin receptor complex CERK1-LYK5 and the intracellular MAPK cascade that leads to chitin-induced immunity.	The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021652 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0010098 suspensor development Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010229 inflorescence development Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G09000

ath:AT1G53570

ath:AT1G54960

ath:AT1G63700

ath:AT5G66850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · LXL04_021652 · OH-1004

Nucleus0.281

Rank 2 · LXL04_021652 · OH-1004

Cell membrane0.256

Rank 3 · LXL04_021652 · OH-1004

Golgi apparatus0.042

Rank 4 · LXL04_021652 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_021652 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase404-659 aa

PF07714.24PK_Tyr_Ser-Thr405-654 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021652	`PF00069.32`	Pkinase	404	659	2.6e-72	244.1
LXL04_021652	`PF07714.24`	PK_Tyr_Ser-Thr	405	654	2e-47	162.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAD5`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase YODA	61.453%	Swiss-Prot	strong database homology
`F4HRJ4`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 3	69.349%	Swiss-Prot	weak database homology
`Q9C5H5`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 5	62.222%	Swiss-Prot	weak database homology
`Q9FZ36`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 2	46.130%	Swiss-Prot	weak database homology
`O22040`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase ANP1	52.222%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card