Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1587 bp · LXL04_021651|LXL04_021651|OH1004|cDNA
ATGGCTATGGCTCCTACCATCAAAGTAATTCTAGGCTCTTTCGCCTTCGCTGTATTTTGGATACTTGCAGTCTTCCCCGCAGTTCCCTTCATGCCAATCGGAAGAACAGCAGGTTCTCTCCTCGGTGCCATGCTCATGGTTCTTTTCCAAGTCATAACCCCCGATCAAGCTTACGCCTCCATTGATCTGCCAATTCTCGGTCTCCTCTTCGGCACAATGGTCGTAAGTGTTTACCTTGAAAGAGCAGACATGTTCAAATA...
1587 bp · LXL04_021651|LXL04_021651|OH1004|CDS
ATGGCTATGGCTCCTACCATCAAAGTAATTCTAGGCTCTTTCGCCTTCGCTGTATTTTGGATACTTGCAGTCTTCCCCGCAGTTCCCTTCATGCCAATCGGAAGAACAGCAGGTTCTCTCCTCGGTGCCATGCTCATGGTTCTTTTCCAAGTCATAACCCCCGATCAAGCTTACGCCTCCATTGATCTGCCAATTCTCGGTCTCCTCTTCGGCACAATGGTCGTAAGTGTTTACCTTGAAAGAGCAGACATGTTCAAATA...
Protein
Download Protein FASTA528 aa · LXL04_021651|LXL04_021651|OH1004|PROTEIN
MAMAPTIKVILGSFAFAVFWILAVFPAVPFMPIGRTAGSLLGAMLMVLFQVITPDQAYASIDLPILGLLFGTMVVSVYLERADMFKYLGKLLAWKTQGPKDLLCRICLISAISSAFFTNDTSCVVLTEFVLKIARQQNLPPHPFLLALASSANIGSSATPIGNPQNLVIAVQSEIPFGEFLSGIAIAMLVGVFVNALILLCMFWKLLSVQKDEEEPPIDVSPEEDVNSHRFSPATMSHLSSQNSHEVSSHHSSPRVKITL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021651 |
|---|---|
| TK1151 ID | TkA05G413970 |
| OH-1004 ID | LXL04_021651 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 92.700 |
| Protein coverage (%) | TK1151 38.318 / OH-1004 7.765Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021651 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:134261764-134263847 (+) | |||||||||
| Description | Similar to LSI2: Silicon efflux transporter LSI2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006583 melanin biosynthetic process from tyrosine Biological Process GO:0007286 spermatid development Biological Process GO:0008283 cell population proliferation Biological Process GO:0035752 lysosomal lumen pH elevation Biological Process GO:0042438 melanin biosynthetic process Biological Process GO:0043473 pigmentation Biological Process GO:0048066 developmental pigmentation Biological Process GO:0055085 transmembrane transport Biological Process GO:0005765 lysosomal membrane Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ddi:DDB_G0289879 dosa:Os03g0107300 dosa:Os10g0547500 hsa:4948 mmu:18431 osa:4349293 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03600.23CitMHS24-474 aaPF02040.21ArsB72-232 aaPF02040.21ArsB337-523 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021651 | PF03600.23 | CitMHS | 24 | 474 | 4.8e-95 | 319.2 |
| LXL04_021651 | PF02040.21 | ArsB | 72 | 232 | 1e-10 | 42.3 |
| LXL04_021651 | PF02040.21 | ArsB | 337 | 523 | 1e-10 | 42.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.