LXL04_021645 | RubberDandelionOmics

Gene overview

LXL04_021645

Reference: OH-1004 Chr: Chr04 Coordinates: 134206005-134207936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · LXL04_021645|LXL04_021645|OH1004|cDNA

ATGTCGTCAGGCTTCCCCGGCGGCCATCCCGACTACTTCAACATCAACATCAGCACCAACAACATCACCGGGAGATCCATGTCTATGATGAATTtgaacaacaacagcaacaacaacaacaacaacaacacacAGGGGTCTTACCGATCACCACTTGCAGGAATTCTAGCCGACCCATCTTCTCAGATCGGACTCCGGCGACCTGACTTGATGGGGAAACGATCTCTGGCTGAATTCCAACACCACCAACAACTCCAGCA...

CDS

Download CDS FASTA

1932 bp · LXL04_021645|LXL04_021645|OH1004|CDS

ATGTCGTCAGGCTTCCCCGGCGGCCATCCCGACTACTTCAACATCAACATCAGCACCAACAACATCACCGGGAGATCCATGTCTATGATGAATTTGAACAACAACAGCAACAACAACAACAACAACAACACACAGGGGTCTTACCGATCACCACTTGCAGGAATTCTAGCCGACCCATCTTCTCAGATCGGACTCCGGCGACCTGACTTGATGGGGAAACGATCTCTGGCTGAATTCCAACACCACCAACAACTCCAGCA...

Protein

Download Protein FASTA

643 aa · LXL04_021645|LXL04_021645|OH1004|PROTEIN

MSSGFPGGHPDYFNINISTNNITGRSMSMMNLNNNSNNNNNNNTQGSYRSPLAGILADPSSQIGLRRPDLMGKRSLAEFQHHQQLQQQAAFFLRNVKQRPYNQHASPVSPLMDFPNSPEVSSVSNLSSSSLSSVPRYGVPVMQQVRPASVQSFNIGNGNFNGVMGNYQHNNRGSYSRVTLPNLAAKQSPASQETEGKMMKRLQELEKQLLLDDEDGENDVSGVTNSEWSETIHNILGSTPVVIPENTVSPSPTSSSSSSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021645`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021645

Location Chr04:134206005-134207936 (-)

Description Similar to SCL8: Scarecrow-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52510`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At1g21450`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At5g48150`	Probable transcription factor involved in phytochrome A (phyA) signal transduction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0545800`	May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane- associated high-affinity chitin-binding protein.	Identification and characterization of two new members of the GRAS gene family in rice responsive to N-acetylchitooligosaccharide elicitor.2003 · DOI: 10.1016/s0167-4781(02)00626-7
`Os07g0583600`	May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane- associated high-affinity chitin-binding protein.	Identification and characterization of two new members of the GRAS gene family in rice responsive to N-acetylchitooligosaccharide elicitor.2003 · DOI: 10.1016/s0167-4781(02)00626-7

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021645 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G21450

ath:AT5G48150

ath:AT5G52510

dosa:Os07g0545800

dosa:Os07g0583600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · LXL04_021645 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_021645 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_021645 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_021645 · OH-1004

Plastid0.017

Rank 5 · LXL04_021645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS274-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021645	`PF03514.21`	GRAS	274	642	1.9e-100	337.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYR7`	Arabidopsis thaliana	Scarecrow-like protein 8	45.925%	Swiss-Prot	moderate database homology
`Q9SDQ3`	Arabidopsis thaliana	Scarecrow-like protein 1	36.876%	Swiss-Prot	moderate database homology
`Q9LDL7`	Arabidopsis thaliana	Scarecrow-like transcription factor PAT1	39.050%	Swiss-Prot	moderate database homology
`Q69VG1`	Oryza sativa subsp. japonica	Chitin-inducible gibberellin-responsive protein 1	36.031%	Swiss-Prot	moderate database homology
`Q8GVE1`	Oryza sativa subsp. japonica	Chitin-inducible gibberellin-responsive protein 2	35.809%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card