LXL04_021630 | RubberDandelionOmics

Gene overview

LXL04_021630

Reference: OH-1004 Chr: Chr04 Coordinates: 133945715-133947128 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_021630|LXL04_021630|OH1004|cDNA

ATGGCCGATAAAGCCGCCGGAGGGCCTGAGCATGAACCATCGCATATTGATTCAGTGAAGGAGAAGGTCACCGAGACGTTCCATGGAAGCGATTCTTCGTCATCGGATACCGAAGGCGTAGGAAAAGACAAAGGGAAACTCTCAGGCAAGAAGGATTATCCCGTACCGATAAAAAAAAAGGTTCAGAGCGTCTCCTGGAAGGATAAACCTGTTCACGATCTCTTAGGAGGCGGCAAAGCTGCTGATATACTTCTATGGAG...

CDS

Download CDS FASTA

798 bp · LXL04_021630|LXL04_021630|OH1004|CDS

ATGGCCGATAAAGCCGCCGGAGGGCCTGAGCATGAACCATCGCATATTGATTCAGTGAAGGAGAAGGTCACCGAGACGTTCCATGGAAGCGATTCTTCGTCATCGGATACCGAAGGCGTAGGAAAAGACAAAGGGAAACTCTCAGGCAAGAAGGATTATCCCGTACCGATAAAAAAAAAGGTTCAGAGCGTCTCCTGGAAGGATAAACCTGTTCACGATCTCTTAGGAGGCGGCAAAGCTGCTGATATACTTCTATGGAG...

Protein

Download Protein FASTA

265 aa · LXL04_021630|LXL04_021630|OH1004|PROTEIN

MADKAAGGPEHEPSHIDSVKEKVTETFHGSDSSSSDTEGVGKDKGKLSGKKDYPVPIKKKVQSVSWKDKPVHDLLGGGKAADILLWRDKKTSIGVLGVATIIWALFELIEYHLLSLLCHILILVLGIHFLWSNTFNLFYRCPQFPEVAIDEATALKVASFLRLEINKALEVLREITSGKDLKEFLAVIACLWVVSVAGNWCNLLTLVYICFVLLQLVPILYEKNKGQADVLIDKAEGELKKQFEVVSEKVLSKVPSMSSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021630`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021630

Location Chr04:133945715-133947128 (-)

Description Similar to RTNLB5: Reticulon-like protein B5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46170`	Reticulon-like protein B5.	No verified direct reference in this release
`At3g61560`	Reticulon-like protein B6.	No verified direct reference in this release
`At4g11220`	Plays a role in the Agrobacterium-mediated plant transformation via its interaction with VirB2, the major component of the T-pilus.	Plant proteins that interact with VirB2, the Agrobacterium tumefaciens pilin protein, mediate plant transformation.2004 · DOI: 10.1105/tpc.104.026476
`At1g64090`	Reticulon-like protein B3.	No verified direct reference in this release
`At4g23630`	Plays a role in the Agrobacterium-mediated plant transformation via its interaction with VirB2, the major component of the T-pilus.	Plant proteins that interact with VirB2, the Agrobacterium tumefaciens pilin protein, mediate plant transformation.2004 · DOI: 10.1105/tpc.104.026476

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021630 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0050687 negative regulation of defense response to virus Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

KEGG gene cross-reference

ath:AT1G64090

ath:AT2G46170

ath:AT3G61560

ath:AT4G11220

ath:AT4G23630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.467

Rank 1 · LXL04_021630 · OH-1004

Cell membrane0.364

Rank 2 · LXL04_021630 · OH-1004

Cytoplasm0.196

Rank 3 · LXL04_021630 · OH-1004

Golgi apparatus0.107

Rank 4 · LXL04_021630 · OH-1004

Lysosome / Vacuole0.083

Rank 5 · LXL04_021630 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02453.24Reticulon81-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021630	`PF02453.24`	Reticulon	81	234	1.5e-48	165.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82352`	Arabidopsis thaliana	Reticulon-like protein B5	53.441%	Swiss-Prot	strong database homology
`Q6DBN4`	Arabidopsis thaliana	Reticulon-like protein B6	51.869%	Swiss-Prot	strong database homology
`Q9SUT9`	Arabidopsis thaliana	Reticulon-like protein B2	51.515%	Swiss-Prot	strong database homology
`Q9SH59`	Arabidopsis thaliana	Reticulon-like protein B3	48.780%	Swiss-Prot	moderate database homology
`Q9SUR3`	Arabidopsis thaliana	Reticulon-like protein B1	54.040%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card