LXL04_021610 | RubberDandelionOmics

Gene overview

LXL04_021610

Reference: OH-1004 Chr: Chr04 Coordinates: 133519073-133521175 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_021610|LXL04_021610|OH1004|cDNA

ATGAGTGAATCCAAGCTCAAGAATATGGCGACAAAAGTTTATGAAGCAATAGGTGTCCAACGATGGCTACCTTCAAGTCCACAATCCGAATCCATGTCAAAATCGAGACATGATCATGTGAATCGCGGCTACAGTACTACTACATCCAATCAACCAATCACAATCGACCAAAACTACATTTCTTGGTTGAAAGAACACCCTTCGGCGATTACGTCATTCCAACAAATGATCAACGCATCAAAAGGGAAACAAATTGTCGT...

CDS

Download CDS FASTA

1083 bp · LXL04_021610|LXL04_021610|OH1004|CDS

ATGAGTGAATCCAAGCTCAAGAATATGGCGACAAAAGTTTATGAAGCAATAGGTGTCCAACGATGGCTACCTTCAAGTCCACAATCCGAATCCATGTCAAAATCGAGACATGATCATGTGAATCGCGGCTACAGTACTACTACATCCAATCAACCAATCACAATCGACCAAAACTACATTTCTTGGTTGAAAGAACACCCTTCGGCGATTACGTCATTCCAACAAATGATCAACGCATCAAAAGGGAAACAAATTGTCGT...

Protein

Download Protein FASTA

360 aa · LXL04_021610|LXL04_021610|OH1004|PROTEIN

MSESKLKNMATKVYEAIGVQRWLPSSPQSESMSKSRHDHVNRGYSTTTSNQPITIDQNYISWLKEHPSAITSFQQMINASKGKQIVVFLDYDGTLSPIVSDPECAFMSDQMRTAVRDVSNHFPTAIISGRSREKVFDFVKLKTVYYSGSHGMDTMGPAPKNVVYDNKYLQKISDNEGNDFIVFQPARDFLSAIEKFSDTWHAQMLREIKERTENIKGVVIEDNRFCLSVHYRHVKNEDYKKLEEELELLLVKNPGFHITK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021610`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021610

Location Chr04:133519073-133521175 (+)

Description Similar to TPP7: Probable trehalose-phosphate phosphatase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78090`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Trehalose-6-phosphate phosphatases from Arabidopsis thaliana: identification by functional complementation of the yeast tps2 mutant.1998 · DOI: 10.1046/j.1365-313x.1998.00064.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0369400`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os07g0624600`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os10g0553300`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os08g0409100`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021610 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0004805 trehalose-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78090

dosa:Os07g0624600

dosa:Os08g0409100

dosa:Os09g0369400

dosa:Os10g0553300

osa:4349333

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_021610 · OH-1004

Nucleus0.292

Rank 2 · LXL04_021610 · OH-1004

Mitochondrion0.206

Rank 3 · LXL04_021610 · OH-1004

Peroxisome0.068

Rank 4 · LXL04_021610 · OH-1004

Cell membrane0.059

Rank 5 · LXL04_021610 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02358.23Trehalose_PPase88-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021610	`PF02358.23`	Trehalose_PPase	88	333	5.4e-56	190.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9S4`	Arabidopsis thaliana	Trehalose-phosphate phosphatase B	45.758%	Swiss-Prot	moderate database homology
`Q6H5L4`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 7	49.329%	Swiss-Prot	moderate database homology
`Q7XI41`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 3	51.736%	Swiss-Prot	strong database homology
`Q9FWQ2`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 2	49.000%	Swiss-Prot	moderate database homology
`Q6ZAL2`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 6	49.664%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card