Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2487 bp · LXL04_021579|LXL04_021579|OH1004|cDNA
ATGTATAGCTCATACGATGAAGACGAGTATCGATTCTTCGATGCGCACGATAGCATTGAGTCCGACGAGCTTATTTCTGAGCCTGCCGAGAGTAGCAACCATGGCGTCTTCGACGACGACGACTCGCCTAACGATTTCGAGTATGATATTTGGGCCAATGCTCCGACAAGCGTTCTTCAACGAAAGCACACGTTTCTCCGATTAATGGGATTGAACGCCGACGATCATATTCCGGTTGATGACGATGTGTTCATAGAGGA...
2487 bp · LXL04_021579|LXL04_021579|OH1004|CDS
ATGTATAGCTCATACGATGAAGACGAGTATCGATTCTTCGATGCGCACGATAGCATTGAGTCCGACGAGCTTATTTCTGAGCCTGCCGAGAGTAGCAACCATGGCGTCTTCGACGACGACGACTCGCCTAACGATTTCGAGTATGATATTTGGGCCAATGCTCCGACAAGCGTTCTTCAACGAAAGCACACGTTTCTCCGATTAATGGGATTGAACGCCGACGATCATATTCCGGTTGATGACGATGTGTTCATAGAGGA...
Protein
Download Protein FASTA828 aa · LXL04_021579|LXL04_021579|OH1004|PROTEIN
MYSSYDEDEYRFFDAHDSIESDELISEPAESSNHGVFDDDDSPNDFEYDIWANAPTSVLQRKHTFLRLMGLNADDHIPVDDDVFIEENEIGIDDRTLQTSGAVLRSPNTSLITEEEHKQEEEEEEEKLSPVSSSSNSVWCADDATCSSSPVSRTDDCNGGGECKEEQQQQYQHQQQHQHQHQQQQGENGGKLMVRAEMLPSPVVVQNFTDKLKVAGTMVKTMNKVKGQFLGRLRSMTSRHSRSHSLPHMPPPPPPPLPEP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021579 |
|---|---|
| TK1151 ID | TkA05G408150 |
| OH-1004 ID | LXL04_021579 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 99.865 / OH-1004 89.372Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021579 |
|---|---|
| Location | Chr04:132795430-132800603 (+) |
| Description | Similar to SPAC3H5.08c: Uncharacterized WD repeat-containing protein C3H5.08c (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006887 exocytosis Biological Process GO:0030334 regulation of cell migration Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0045724 positive regulation of cilium assembly Biological Process GO:0060627 regulation of vesicle-mediated transport Biological Process GO:0061512 protein localization to cilium Biological Process GO:0061824 cytosolic ciliogenesis Biological Process GO:1902018 negative regulation of cilium assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | bta:286825 hsa:54521 mmu:72404 spo:2543641 xla:734726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24807.2WD40_CDC20-Fz270-325 aaPF25172.2Beta-prop_WDR3_2nd278-494 aaPF25174.2Beta-prop_THOC3286-323 aaPF23381.2Beta-prop_IFT122_1st287-321 aaPF24814.2WD40_Prp19287-350 aaPF24817.2WD40_WDHD1_1st288-338 aaPF23414.2Beta-prop_EML_2288-430 aaPF25175.2Beta-prop_WDR5289-325 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021579 | PF24807.2 | WD40_CDC20-Fz | 270 | 325 | 2.3e-22 | 80.3 |
| LXL04_021579 | PF25172.2 | Beta-prop_WDR3_2nd | 278 | 494 | 2.8e-27 | 96.4 |
| LXL04_021579 | PF25174.2 | Beta-prop_THOC3 | 286 | 323 | 1.2e-35 | 123.5 |
| LXL04_021579 | PF23381.2 | Beta-prop_IFT122_1st | 287 | 321 | 5.3e-34 | 118.5 |
| LXL04_021579 | PF24814.2 | WD40_Prp19 | 287 | 350 | 1.4e-23 | 84.1 |
| LXL04_021579 | PF24817.2 | WD40_WDHD1_1st | 288 | 338 | 3.5e-22 | 79.7 |
| LXL04_021579 | PF23414.2 | Beta-prop_EML_2 | 288 | 430 | 3.4e-20 | 73.2 |
| LXL04_021579 | PF25175.2 | Beta-prop_WDR5 | 289 | 325 | 1.2e-38 | 133.8 |
| LXL04_021579 | PF00400.39 | WD40 | 289 | 320 | 2e-33 | 114.1 |
| LXL04_021579 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 289 | 329 | 1e-23 | 84.9 |
| LXL04_021579 | PF25175.2 | Beta-prop_WDR5 | 386 | 607 | 1.2e-38 | 133.8 |
| LXL04_021579 | PF25173.2 | Beta-prop_WDR3_1st | 392 | 472 | 1.7e-24 | 87.3 |
| LXL04_021579 | PF24814.2 | WD40_Prp19 | 392 | 505 | 1.4e-23 | 84.1 |
| LXL04_021579 | PF24807.2 | WD40_CDC20-Fz | 392 | 559 | 2.3e-22 | 80.3 |
| LXL04_021579 | PF00400.39 | WD40 | 393 | 428 | 2e-33 | 114.1 |
| LXL04_021579 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 393 | 455 | 1e-23 | 84.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.