LXL04_021549 | RubberDandelionOmics

Gene overview

LXL04_021549

Reference: OH-1004 Chr: Chr04 Coordinates: 132237469-132237813 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · LXL04_021549|LXL04_021549|OH1004|cDNA

ATGGCCCCGACTAGCATAGCAGTTCCCACGGCGGCGGCGACGGTAGATCAGGCGGCGGTGTTGAGAACGAGGAACGAGGAACTGGAGAGAGAATTAAAACGGAGCATGGAAAGAGAGGAGACGATGAAGATGGAGTTGCAGAAGGCGTTTGAGAGGCTGCAGGTGGCGGAGGACGCGGAGGAGCGACTTTGCTCGCAGCTTGGTGAGCTTGAAGCCGAGGCCATGGATCAAGCACGTGAGTATAGAGAGCGGCTTGTAAC...

CDS

Download CDS FASTA

345 bp · LXL04_021549|LXL04_021549|OH1004|CDS

ATGGCCCCGACTAGCATAGCAGTTCCCACGGCGGCGGCGACGGTAGATCAGGCGGCGGTGTTGAGAACGAGGAACGAGGAACTGGAGAGAGAATTAAAACGGAGCATGGAAAGAGAGGAGACGATGAAGATGGAGTTGCAGAAGGCGTTTGAGAGGCTGCAGGTGGCGGAGGACGCGGAGGAGCGACTTTGCTCGCAGCTTGGTGAGCTTGAAGCCGAGGCCATGGATCAAGCACGTGAGTATAGAGAGCGGCTTGTAAC...

Protein

Download Protein FASTA

114 aa · LXL04_021549|LXL04_021549|OH1004|PROTEIN

MAPTSIAVPTAAATVDQAAVLRTRNEELERELKRSMEREETMKMELQKAFERLQVAEDAEERLCSQLGELEAEAMDQAREYRERLVTLMEQLSAAQKLIQTYGFSPESDTINCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021549`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021549

Location Chr04:132237469-132237813 (+)

Description Similar to LSU2: Protein RESPONSE TO LOW SULFUR 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24660`	May be involved in defense responses monitoring.	No verified direct reference in this release
`At3g49580`	Protein RESPONSE TO LOW SULFUR 1.	No verified direct reference in this release
`At5g24655`	Required for flower development in short-day conditions.	No verified direct reference in this release
`At3g49570`	Protein RESPONSE TO LOW SULFUR 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021549 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010438 cellular response to sulfur starvation Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0048587 regulation of short-day photoperiodism, flowering Biological Process

GO:0098869 cellular oxidant detoxification Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G49570

ath:AT3G49580

ath:AT5G24655

ath:AT5G24660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · LXL04_021549 · OH-1004

Nucleus0.305

Rank 2 · LXL04_021549 · OH-1004

Cell membrane0.072

Rank 3 · LXL04_021549 · OH-1004

Golgi apparatus0.071

Rank 4 · LXL04_021549 · OH-1004

Mitochondrion0.050

Rank 5 · LXL04_021549 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24980.2LSU21-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021549	`PF24980.2`	LSU	21	74	5.1e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIR9`	Arabidopsis thaliana	Protein RESPONSE TO LOW SULFUR 2	47.312%	Swiss-Prot	moderate database homology
`Q9SCK1`	Arabidopsis thaliana	Protein RESPONSE TO LOW SULFUR 1	46.237%	Swiss-Prot	moderate database homology
`Q8L8S2`	Arabidopsis thaliana	Protein RESPONSE TO LOW SULFUR 4	44.086%	Swiss-Prot	moderate database homology
`Q9SCK2`	Arabidopsis thaliana	Protein RESPONSE TO LOW SULFUR 3	63.636%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card