LXL04_021515 | RubberDandelionOmics

Gene overview

LXL04_021515

Reference: OH-1004 Chr: Chr04 Coordinates: 131499121-131500164 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1044 bp · LXL04_021515|LXL04_021515|OH1004|cDNA

ATGTCTCTACCAATTGTTTCCGACAAGGAGGTGGATATCGTGATCGGAGCTTTCCGATCCGACCTCACGTCTTTCATGGAGGAATGGCGACCTATATTTTCTCGATTCCATTTGATAATCGTAAAAGATCCAGATCTTAAAGAGCTAAAAATCCCCGAAGGTTTTGACGTTCGTGTCTACACGGAAACCGATATACTCAAAGTCGTCGGGCCTTCTAACGTCGCGCTCTTTTCCGGCTACTCCTGTCGCTACTTCGGCTA...

CDS

Download CDS FASTA

1044 bp · LXL04_021515|LXL04_021515|OH1004|CDS

ATGTCTCTACCAATTGTTTCCGACAAGGAGGTGGATATCGTGATCGGAGCTTTCCGATCCGACCTCACGTCTTTCATGGAGGAATGGCGACCTATATTTTCTCGATTCCATTTGATAATCGTAAAAGATCCAGATCTTAAAGAGCTAAAAATCCCCGAAGGTTTTGACGTTCGTGTCTACACGGAAACCGATATACTCAAAGTCGTCGGGCCTTCTAACGTCGCGCTCTTTTCCGGCTACTCCTGTCGCTACTTCGGCTA...

Protein

Download Protein FASTA

347 aa · LXL04_021515|LXL04_021515|OH1004|PROTEIN

MSLPIVSDKEVDIVIGAFRSDLTSFMEEWRPIFSRFHLIIVKDPDLKELKIPEGFDVRVYTETDILKVVGPSNVALFSGYSCRYFGYLVSNKKYVISIDDDCTPAKSNTGEYVDIVTGHVTNLKTPATPFFFNTLYDPYQKGSDFVRGYPFSLRTGVPCAVSCGLWLNIADYDAPTQALKPDLRNTRHVDAVLTVPNKAMMPMSGINIAFDRELVGAAVMPALKLVQEGKVRWETMEDVWCGLVVKAVCDHLQLGVKSGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021515`
TK1151 ID	TkA05G401360
OH-1004 ID	LXL04_021515
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021515

Location Chr04:131499121-131500164 (-)

Description Similar to RGP5: Probable UDP-arabinopyranose mutase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16510`	Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	No verified direct reference in this release
`At3g02230`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	Arabidopsis reversibly glycosylated polypeptides 1 and 2 are essential for pollen development.2006 · DOI: 10.1104/pp.106.086363 The interconversion of UDP-arabinopyranose and UDP-arabinofuranose is indispensable for plant development in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083931
`At5g15650`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	Arabidopsis reversibly glycosylated polypeptides 1 and 2 are essential for pollen development.2006 · DOI: 10.1104/pp.106.086363 The interconversion of UDP-arabinopyranose and UDP-arabinofuranose is indispensable for plant development in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083931

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0660400`	Probable inactive UDP-L-arabinose mutase.	Glucosylation activity and complex formation of two classes of reversibly glycosylated polypeptides.2002 · DOI: 10.1104/pp.010720

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021515 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0019567 arabinose biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0033356 UDP-L-arabinose metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G02230

ath:AT5G15650

ath:AT5G16510

dosa:Os04g0660400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651

Rank 1 · LXL04_021515 · OH-1004

Nucleus0.216

Rank 2 · LXL04_021515 · OH-1004

Golgi apparatus0.122

Rank 3 · LXL04_021515 · OH-1004

Endoplasmic reticulum0.102

Rank 4 · LXL04_021515 · OH-1004

Cell membrane0.070

Rank 5 · LXL04_021515 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03214.20RGP7-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021515	`PF03214.20`	RGP	7	344	3.5e-173	576.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFD2`	Arabidopsis thaliana	Probable UDP-arabinopyranose mutase 5	68.876%	Swiss-Prot	strong database homology
`Q9SRT9`	Arabidopsis thaliana	UDP-arabinopyranose mutase 1	47.965%	Swiss-Prot	moderate database homology
`Q9LFW1`	Arabidopsis thaliana	UDP-arabinopyranose mutase 2	47.813%	Swiss-Prot	moderate database homology
`Q7FAY6`	Oryza sativa subsp. japonica	Probable inactive UDP-arabinopyranose mutase 2	63.324%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card