LXL04_021498 | RubberDandelionOmics

Gene overview

LXL04_021498

Reference: OH-1004 Chr: Chr04 Coordinates: 131277841-131282352 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2112 bp · LXL04_021498|LXL04_021498|OH1004|cDNA

ATGGAGGAGGCGAACAAAACACAACACACGTGTAATTGGTTAAAAGGCAAATTGACCTTGTTCAAAGTCCAAGGCTTTTGGAACATTCCAGAGTTCCAAAACTTTGAGAACATCCATGAAAGCCATAAGGCCCATCCAAGCGATATACTACTATGCAGTTTCCTCAAAACCGGCACCACATGGCTCAAGGCCTTGTCTTTCGCCATTGTAACCCGACAAAACTTCGACCAATCTTCTAGCCCTTTGCTCAAATTTGTGCC...

CDS

Download CDS FASTA

2112 bp · LXL04_021498|LXL04_021498|OH1004|CDS

ATGGAGGAGGCGAACAAAACACAACACACGTGTAATTGGTTAAAAGGCAAATTGACCTTGTTCAAAGTCCAAGGCTTTTGGAACATTCCAGAGTTCCAAAACTTTGAGAACATCCATGAAAGCCATAAGGCCCATCCAAGCGATATACTACTATGCAGTTTCCTCAAAACCGGCACCACATGGCTCAAGGCCTTGTCTTTCGCCATTGTAACCCGACAAAACTTCGACCAATCTTCTAGCCCTTTGCTCAAATTTGTGCC...

Protein

Download Protein FASTA

703 aa · LXL04_021498|LXL04_021498|OH1004|PROTEIN

MEEANKTQHTCNWLKGKLTLFKVQGFWNIPEFQNFENIHESHKAHPSDILLCSFLKTGTTWLKALSFAIVTRQNFDQSSSPLLKFVPHACIPLLEKDFHQIKQKHTTSDFPLIASHLPYSLLPESVISSNCKIVYIYRNIKDVMVSYYEFVRVYNVSVEDAPFEVMFDEFCEGIMACGPYWDHILEYWKASQERPERFLFLKYEDMKWDTEGGVVENIIKLCSFENLKNLQVNKSGKHRADVFPIENRLYFRKAEDGDWE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021498`
TK1151 ID	TkA05G400840
OH-1004 ID	LXL04_021498
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.200
Protein coverage (%)	TK1151 94.702 / OH-1004 19.346 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021498

Location Chr04:131277841-131282352 (+)

Description Similar to Flavonol 3-sulfotransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18590`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of desulfo-glucosinolates (dsGSs), the final step in the biosynthesis of the glucosinolate core structure.	Desulfoglucosinolate sulfotransferases from Arabidopsis thaliana catalyze the final step in the biosynthesis of the glucosinolate core structure.2004 · DOI: 10.1074/jbc.m407681200 The three desulfoglucosinolate sulfotransferase proteins in Arabidopsis have different substrate specificities and are differentially expressed.2006 · DOI: 10.1111/j.1742-4658.2005.05048.x Kinetics and substrate specificities of desulfo-glucosinolate sulfotransferases in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1399-3054.2008.01182.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0008146 sulfotransferase activity Molecular Function

GO:0047366 quercetin-3-sulfate 4'-sulfotransferase activity Molecular Function

GO:0047894 flavonol 3-sulfotransferase activity Molecular Function

KEGG gene cross-reference

ag:AAA33342

ag:AAA33343

ag:AAA61638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.747

Rank 1 · LXL04_021498 · OH-1004

Nucleus0.289

Rank 2 · LXL04_021498 · OH-1004

Endoplasmic reticulum0.069

Rank 3 · LXL04_021498 · OH-1004

Cell membrane0.062

Rank 4 · LXL04_021498 · OH-1004

Mitochondrion0.057

Rank 5 · LXL04_021498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00685.34Sulfotransfer_146-279 aa

PF00098.29zf-CCHC447-463 aa

PF00685.34Sulfotransfer_1580-700 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021498	`PF00685.34`	Sulfotransfer_1	46	279	8.3e-96	321.0
LXL04_021498	`PF00098.29`	zf-CCHC	447	463	1.7e-06	28.5
LXL04_021498	`PF00685.34`	Sulfotransfer_1	580	700	8.3e-96	321.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ80`	Arabidopsis thaliana	Cytosolic sulfotransferase 17	44.170%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card