LXL04_021461 | RubberDandelionOmics

Gene overview

LXL04_021461

Reference: OH-1004 Chr: Chr04 Coordinates: 130682288-130684896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · LXL04_021461|LXL04_021461|OH1004|cDNA

ATGGAGCCGATGAGAGCTGGAATAGTTCATGTGTCCGTAAGAATGAAGCTTCTTATTGCAGTTCTTGTGTTGCAACTTTGCTTCGCTGGGTTTCACATAGTGTCTAGGCTTGCACTTAATATCGGAATCAGCAAAGTCGTTTACCCTGTTTACAGAAACCTCCTCGCGTTGATTCTCTTGGCTCCTTTTGCTTACTTCTATGAGAAGAAAGAAAGGCCACCCCTCACCTTTTCGTTACTAGTTCAGTTTTTCTTCCTGGC...

CDS

Download CDS FASTA

1101 bp · LXL04_021461|LXL04_021461|OH1004|CDS

ATGGAGCCGATGAGAGCTGGAATAGTTCATGTGTCCGTAAGAATGAAGCTTCTTATTGCAGTTCTTGTGTTGCAACTTTGCTTCGCTGGGTTTCACATAGTGTCTAGGCTTGCACTTAATATCGGAATCAGCAAAGTCGTTTACCCTGTTTACAGAAACCTCCTCGCGTTGATTCTCTTGGCTCCTTTTGCTTACTTCTATGAGAAGAAAGAAAGGCCACCCCTCACCTTTTCGTTACTAGTTCAGTTTTTCTTCCTGGC...

Protein

Download Protein FASTA

366 aa · LXL04_021461|LXL04_021461|OH1004|PROTEIN

MEPMRAGIVHVSVRMKLLIAVLVLQLCFAGFHIVSRLALNIGISKVVYPVYRNLLALILLAPFAYFYEKKERPPLTFSLLVQFFFLALVGITANQGFYILGLYYATPAFASAMQNSVPAITFLMASALRLEKVNITRRDGLAKVIGTLASVGGATVITLYKGPPLMHQDASVNNHDDMMLSESPKMLNWTWGCIYLLGHCLSWAGWMVFQTPVVRKYPAKLSLTCFTCFFGLIQFMVIAAFVERDAMKWKIKSGEELFTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021461`
TK1151 ID	TkA05G398080
OH-1004 ID	LXL04_021461
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 100.000 / OH-1004 69.399 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021461

Location Chr04:130682288-130684896 (-)

Description Similar to At3g18200: WAT1-related protein At3g18200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18200`	WAT1-related protein At3g18200.	No verified direct reference in this release
`At1g75500`	Required for secondary wall formation in fibers, especially in short days conditions.	Walls are thin 1 (WAT1), an Arabidopsis homolog of Medicago truncatula NODULIN21, is a tonoplast-localized protein required for secondary wall formation in fibers.2010 · DOI: 10.1111/j.1365-313x.2010.04256.x Light-regulated compensation of wat1 (walls are thin1) growth and secondary cell wall phenotypes is auxin-independent.2010 · DOI: 10.4161/psb.5.10.13103 Arabidopsis wat1 (walls are thin1)-mediated resistance to the bacterial vascular pathogen, Ralstonia solanacearum, is accompanied by cross-regulation of salicylic acid and tryptophan metabolism.2013 · DOI: 10.1111/tpj.12027
`At3g53210`	WAT1-related protein At3g53210.	No verified direct reference in this release
`At4g08290`	WAT1-related protein At4g08290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021461 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090355 positive regulation of auxin metabolic process Biological Process

GO:0090358 positive regulation of L-tryptophan metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G75500

ath:AT3G18200

ath:AT3G53210

ath:AT4G08290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.409

Rank 1 · LXL04_021461 · OH-1004

Lysosome / Vacuole0.244

Rank 2 · LXL04_021461 · OH-1004

Endoplasmic reticulum0.159

Rank 3 · LXL04_021461 · OH-1004

Golgi apparatus0.085

Rank 4 · LXL04_021461 · OH-1004

Cytoplasm0.079

Rank 5 · LXL04_021461 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892.27EamA18-158 aa

PF00892.27EamA191-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021461	`PF00892.27`	EamA	18	158	1.3e-27	97.5
LXL04_021461	`PF00892.27`	EamA	191	329	1.3e-27	97.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV20`	Arabidopsis thaliana	WAT1-related protein At3g18200	66.295%	Swiss-Prot	strong database homology
`Q94AP3`	Arabidopsis thaliana	Protein WALLS ARE THIN 1	60.983%	Swiss-Prot	strong database homology
`F4J9A3`	Arabidopsis thaliana	WAT1-related protein At3g53210	47.839%	Swiss-Prot	moderate database homology
`Q9SUF1`	Arabidopsis thaliana	WAT1-related protein At4g08290	37.466%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card