LXL04_021450 | RubberDandelionOmics

Gene overview

LXL04_021450

Reference: OH-1004 Chr: Chr04 Coordinates: 130357347-130359132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · LXL04_021450|LXL04_021450|OH1004|cDNA

ATGACAATCCAAGCAGAAACCCACCAAATCAAGAAACACAGACACCCCTCAAGAAAACACAGCAAGAAGAAAGACAGCGTCACAGTTGTAGTAAACGAGAAATCCCCTCTGATTCCCAAGAAAAAAGGCGCTCACAATGAGTTCAATGGCGCGTCGATGTCGGGGGCTGTCATGAACCTTTCCACCACCATCATCGGCGCCGGAATAATGGCACTCCCAGCCACCATGAAGGTATTAGGCCTCGGCCTTGGCATCGCGGT...

CDS

Download CDS FASTA

1413 bp · LXL04_021450|LXL04_021450|OH1004|CDS

ATGACAATCCAAGCAGAAACCCACCAAATCAAGAAACACAGACACCCCTCAAGAAAACACAGCAAGAAGAAAGACAGCGTCACAGTTGTAGTAAACGAGAAATCCCCTCTGATTCCCAAGAAAAAAGGCGCTCACAATGAGTTCAATGGCGCGTCGATGTCGGGGGCTGTCATGAACCTTTCCACCACCATCATCGGCGCCGGAATAATGGCACTCCCAGCCACCATGAAGGTATTAGGCCTCGGCCTTGGCATCGCGGT...

Protein

Download Protein FASTA

470 aa · LXL04_021450|LXL04_021450|OH1004|PROTEIN

MTIQAETHQIKKHRHPSRKHSKKKDSVTVVVNEKSPLIPKKKGAHNEFNGASMSGAVMNLSTTIIGAGIMALPATMKVLGLGLGIAVIVLVAILSEATVRILLKYSRPGGSDSYGGLMGDAFGDVGKKMLQACVVINNIGVLIIYMIIIGDVVAGSSLDGVHHPGLLEGWFGPHWWTGRIFVLLVTTLGVFVPLASLKRMDSLSVTSSLAVALAVVFLIILAGIAIVKMASGTLQMPRFLPNITDVNSVWNLFTAVPVLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021450`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021450

Location Chr04:130357347-130359132 (+)

Description Similar to AVT6A: Amino acid transporter AVT6A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g30390`	Amino acid transporter AVT6A.	No verified direct reference in this release
`At5g38820`	Amino acid transporter AVT6B.	No verified direct reference in this release
`At3g56200`	Amino acid transporter AVT6C.	No verified direct reference in this release
`At2g40420`	Amino acid transporter AVT6D.	No verified direct reference in this release
`At1g80510`	Amino acid transporter AVT6E.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021450 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G80510

ath:AT2G40420

ath:AT3G30390

ath:AT3G56200

ath:AT5G38820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.350

Rank 1 · LXL04_021450 · OH-1004

Lysosome / Vacuole0.329

Rank 2 · LXL04_021450 · OH-1004

Endoplasmic reticulum0.175

Rank 3 · LXL04_021450 · OH-1004

Golgi apparatus0.113

Rank 4 · LXL04_021450 · OH-1004

Cytoplasm0.113

Rank 5 · LXL04_021450 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490.25Aa_trans51-453 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021450	`PF01490.25`	Aa_trans	51	453	1.3e-49	169.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI61`	Arabidopsis thaliana	Amino acid transporter AVT6A	64.798%	Swiss-Prot	strong database homology
`F4KBM7`	Arabidopsis thaliana	Amino acid transporter AVT6B	61.224%	Swiss-Prot	strong database homology
`Q9LYM2`	Arabidopsis thaliana	Amino acid transporter AVT6C	44.393%	Swiss-Prot	moderate database homology
`Q0WQJ3`	Arabidopsis thaliana	Amino acid transporter AVT6D	42.792%	Swiss-Prot	moderate database homology
`Q9M8L9`	Arabidopsis thaliana	Amino acid transporter AVT6E	41.972%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card