LXL04_021436 | RubberDandelionOmics

Gene overview

LXL04_021436

Reference: OH-1004 Chr: Chr04 Coordinates: 129732660-129736435 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · LXL04_021436|LXL04_021436|OH1004|cDNA

ATGGAACCTCGACCTCGTTTCTGCTCTATGATCATGGCTTTGTTTTTTATCTCATGGGTTTCTTCTGCAACTGCGTTGCTTTCTCCCAAAGGTGTCAATTTCGAAGTGCAAGCTTTGATGAACATAAAGAATGGTTTGGAGGATCCGCATGGTGTCTTGAACTGGGATGCAGATGCTGTTGATCCATGCAGCTGGACGATGATCACTTGTTCTTCTGATAAATTCGTCATTGGGCTGGGAAGTCCAAGCCAAAATCTATC...

CDS

Download CDS FASTA

1875 bp · LXL04_021436|LXL04_021436|OH1004|CDS

ATGGAACCTCGACCTCGTTTCTGCTCTATGATCATGGCTTTGTTTTTTATCTCATGGGTTTCTTCTGCAACTGCGTTGCTTTCTCCCAAAGGTGTCAATTTCGAAGTGCAAGCTTTGATGAACATAAAGAATGGTTTGGAGGATCCGCATGGTGTCTTGAACTGGGATGCAGATGCTGTTGATCCATGCAGCTGGACGATGATCACTTGTTCTTCTGATAAATTCGTCATTGGGCTGGGAAGTCCAAGCCAAAATCTATC...

Protein

Download Protein FASTA

624 aa · LXL04_021436|LXL04_021436|OH1004|PROTEIN

MEPRPRFCSMIMALFFISWVSSATALLSPKGVNFEVQALMNIKNGLEDPHGVLNWDADAVDPCSWTMITCSSDKFVIGLGSPSQNLSGFLSPSIGNLTNLQTVLLQNNRILGPLPFELGRLHKLQTLDISNNMFTGEIPPSLADIKTLQYLRLNNNSLTGPIPQPLANLTQLTFLDLSFNNLSGPVPKFQAKTFNVMGNPIICATGTEQDCNGTTPTSMLLPLNTQENSNPSVMPKTHKMALAFGTSLGCFCLLFFGFGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021436`
TK1151 ID	TkA05G394580
OH-1004 ID	LXL04_021436
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021436

Location Chr04:129732660-129736435 (+)

Description Similar to NIK2: Protein NSP-INTERACTING KINASE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At5g16000`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.2008 · DOI: 10.1371/journal.ppat.1000247 NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171 CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354
`At2g23950`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354 A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0274500`	LRR receptor kinase that may be involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021436 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007639 homeostasis of number of meristem cells Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010088 phloem development Biological Process

GO:0034504 protein localization to nucleus Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0040015 negative regulation of multicellular organism growth Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0048653 anther development Biological Process

GO:0051607 defense response to virus Biological Process

GO:0140374 antiviral innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G60800

ath:AT2G23950

ath:AT3G25560

ath:AT5G16000

dosa:Os06g0274500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.888

Rank 1 · LXL04_021436 · OH-1004

Cytoplasm0.076

Rank 2 · LXL04_021436 · OH-1004

Endoplasmic reticulum0.073

Rank 3 · LXL04_021436 · OH-1004

Nucleus0.046

Rank 4 · LXL04_021436 · OH-1004

Lysosome / Vacuole0.021

Rank 5 · LXL04_021436 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_233-71 aa

PF23598.2LRR_1493-177 aa

PF12799.14LRR_498-132 aa

PF13855.13LRR_898-158 aa

PF13855.13LRR_8144-182 aa

PF12799.14LRR_4147-184 aa

PF00069.32Pkinase305-570 aa

PF07714.24PK_Tyr_Ser-Thr307-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021436	`PF08263.18`	LRRNT_2	33	71	1.5e-11	45.1
LXL04_021436	`PF23598.2`	LRR_14	93	177	3.4e-09	36.6
LXL04_021436	`PF12799.14`	LRR_4	98	132	7e-12	45.9
LXL04_021436	`PF13855.13`	LRR_8	98	158	2e-07	31.4
LXL04_021436	`PF13855.13`	LRR_8	144	182	2e-07	31.4
LXL04_021436	`PF12799.14`	LRR_4	147	184	7e-12	45.9
LXL04_021436	`PF00069.32`	Pkinase	305	570	1.2e-42	146.9
LXL04_021436	`PF07714.24`	PK_Tyr_Ser-Thr	307	573	9.4e-44	150.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	76.364%	Swiss-Prot	strong database homology
`Q9LFS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 5	71.519%	Swiss-Prot	strong database homology
`Q0WVM4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 2	62.107%	Swiss-Prot	strong database homology
`Q93ZS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	62.279%	Swiss-Prot	strong database homology
`Q9FP13`	Oryza sativa subsp. japonica	LRR receptor kinase SERL2	67.261%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card