LXL04_021414 | RubberDandelionOmics

Gene overview

LXL04_021414

Reference: OH-1004 Chr: Chr04 Coordinates: 129346094-129350680 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1731 bp · LXL04_021414|LXL04_021414|OH1004|cDNA

ATGCTTTCTAACTTTTCCCCTCCGAAAATCGTAGTAGCTGGACCATCGAAAACAAACACCGGATCAACGTCAATGCCGTCGGCTCCTGTAATCGGGGTGGTAATATTTCTGCTCAAGGACAACACGGTTCTTTTAGGGCGTCGCCGAGCTTCAGTCGGCGACAACACCTTCGCACTCCCCGGCGGCCGCCTTGAGTTTGgTGAAAGCTTTGAGGAATGTGCAGCACGAGAGGTGAAGGAGGAAACAGGGTTAGATATCAA...

CDS

Download CDS FASTA

1731 bp · LXL04_021414|LXL04_021414|OH1004|CDS

ATGCTTTCTAACTTTTCCCCTCCGAAAATCGTAGTAGCTGGACCATCGAAAACAAACACCGGATCAACGTCAATGCCGTCGGCTCCTGTAATCGGGGTGGTAATATTTCTGCTCAAGGACAACACGGTTCTTTTAGGGCGTCGCCGAGCTTCAGTCGGCGACAACACCTTCGCACTCCCCGGCGGCCGCCTTGAGTTTGGTGAAAGCTTTGAGGAATGTGCAGCACGAGAGGTGAAGGAGGAAACAGGGTTAGATATCAA...

Protein

Download Protein FASTA

576 aa · LXL04_021414|LXL04_021414|OH1004|PROTEIN

MLSNFSPPKIVVAGPSKTNTGSTSMPSAPVIGVVIFLLKDNTVLLGRRRASVGDNTFALPGGRLEFGESFEECAAREVKEETGLDIKDIKYLTITNNVFTEGEKPLHIVAVYMRASLSDPDQIPENVEPDKCYGWDWYDWKNLPQPLFPPLETMLKSEFSPFPIDLNCTYAQKIKKSCTYAKVKKKYRFFGNFFQRIVMIKNVLEGSEVGFLKGITFQSIFLSRLFRLLVGGYFIAIPTKMPTTKRVRQINDGPTSVSDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021414`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021414

Location Chr04:129346094-129350680 (-)

Description Similar to NUDT1: Nudix hydrolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68760`	Mediates the hydrolysis of some nucleoside diphosphate derivatives.	A nudix enzyme removes pyrophosphate from dihydroneopterin triphosphate in the folate synthesis pathway of bacteria and plants.2005 · DOI: 10.1074/jbc.m413759200 Comprehensive analysis of cytosolic Nudix hydrolases in Arabidopsis thaliana.2005 · DOI: 10.1074/jbc.m503536200 AtNUDX1, an 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphate pyrophosphohydrolase, is responsible for eliminating oxidized nucleotides in Arabidopsis.2007 · DOI: 10.1093/pcp/pcm112

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021414 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000302 response to reactive oxygen species Biological Process

GO:0006195 purine nucleotide catabolic process Biological Process

GO:0006203 dGTP catabolic process Biological Process

GO:0006396 RNA processing Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009217 purine deoxyribonucleoside triphosphate catabolic process Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0042178 xenobiotic catabolic process Biological Process

GO:0042262 DNA protection Biological Process

GO:0055086 nucleobase-containing small molecule metabolic process Biological Process

KEGG gene cross-reference

ag:AFW17224

ath:AT1G68760

hsa:55270

mmu:214254

mmu:70650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · LXL04_021414 · OH-1004

Nucleus0.493

Rank 2 · LXL04_021414 · OH-1004

Mitochondrion0.067

Rank 3 · LXL04_021414 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_021414 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_021414 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293.35NUDIX31-148 aa

PF04046.22PSP396-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021414	`PF00293.35`	NUDIX	31	148	3.1e-18	66.8
LXL04_021414	`PF04046.22`	PSP	396	436	6.6e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA40`	Arabidopsis thaliana	Nudix hydrolase 1	63.971%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card