LXL04_021213 | RubberDandelionOmics

Gene overview

LXL04_021213

Reference: OH-1004 Chr: Chr04 Coordinates: 124723256-124727664 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2538 bp · LXL04_021213|LXL04_021213|OH1004|cDNA

ATGATGTCCGTAACAACTCCTCCTCATTTCAAATTCGGTATTTTTATTCCTCAAATTCAATCCCATGTTGAAACATCTTCGATGATTTTAAAAACCTCAAGAACCAGAAGAACATTTCAAAATTCACATCCATCGTCTTCATTCAATTCGTTAAACGTGAAACTACGCTCTGTACGTCAAGTCATCACAAGAATCAGCTGCAGCAGTGACAGTGGTGGCGCATTTCATGACGGTACTCCACAAAAAGTTTCCGATGATAT...

CDS

Download CDS FASTA

2538 bp · LXL04_021213|LXL04_021213|OH1004|CDS

ATGATGTCCGTAACAACTCCTCCTCATTTCAAATTCGGTATTTTTATTCCTCAAATTCAATCCCATGTTGAAACATCTTCGATGATTTTAAAAACCTCAAGAACCAGAAGAACATTTCAAAATTCACATCCATCGTCTTCATTCAATTCGTTAAACGTGAAACTACGCTCTGTACGTCAAGTCATCACAAGAATCAGCTGCAGCAGTGACAGTGGTGGCGCATTTCATGACGGTACTCCACAAAAAGTTTCCGATGATAT...

Protein

Download Protein FASTA

845 aa · LXL04_021213|LXL04_021213|OH1004|PROTEIN

MMSVTTPPHFKFGIFIPQIQSHVETSSMILKTSRTRRTFQNSHPSSSFNSLNVKLRSVRQVITRISCSSDSGGAFHDGTPQKVSDDISDYKANSSPNSGDAYVGMFIRMLGLDNDILDREQAVDALWKYSLGGKQCVDAIMKSRGSVFLTVNLLNSESTIACEAAAGLLRTISSVNIYRDFVAESGAIQEITSLLRRPSLTSEIKEQSLCLLANLSVDEKLRLQIANTDLLPLLIKFLDDEEDMKVIEASGGVLANLALS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021213`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_021213`
Location	Chr04:124723256-124727664 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021213` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000209 protein polyubiquitination Biological Process GO:0000578 embryonic axis specification Biological Process GO:0000902 cell morphogenesis Biological Process GO:0001708 cell fate specification Biological Process GO:0001709 cell fate determination Biological Process GO:0001894 tissue homeostasis Biological Process GO:0002053 positive regulation of mesenchymal cell proliferation Biological Process GO:0003094 glomerular filtration Biological Process GO:0003401 axis elongation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process
KEGG gene cross-reference	bta:539003 cfa:477032 mmu:12387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.342

Rank 1 · LXL04_021213 · OH-1004

Cytoplasm0.306

Rank 2 · LXL04_021213 · OH-1004

Plastid0.188

Rank 3 · LXL04_021213 · OH-1004

Cell membrane0.177

Rank 4 · LXL04_021213 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_021213 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25598.2ARM_PUB152-287 aa

PF24768.2ARM_ARMC5208-288 aa

PF25598.2ARM_PUB410-543 aa

PF24768.2ARM_ARMC5425-618 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021213	`PF25598.2`	ARM_PUB	152	287	4.4e-13	50.0
LXL04_021213	`PF24768.2`	ARM_ARMC5	208	288	4e-24	86.2
LXL04_021213	`PF25598.2`	ARM_PUB	410	543	4.4e-13	50.0
LXL04_021213	`PF24768.2`	ARM_ARMC5	425	618	4e-24	86.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card