LXL04_021183 | RubberDandelionOmics

Gene overview

LXL04_021183

Reference: OH-1004 Chr: Chr04 Coordinates: 123580318-123582254 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1824 bp · LXL04_021183|LXL04_021183|OH1004|cDNA

ATGGAAACCCTTAATCTTCTTGCAATAATATTCCTCTGTGTTCTCTGTTTCCAATCGGAAGTTTCCTTTTCCAACATCGACGCCGACAGAGACGCACTCATCAGATTCAGCTCCGCCGTAAATGGCAACACAATCCAGTGGAACATTTCCAACCCATCACCGTGTTCATGGAAAGGAGTCACATGCAGCACCACGATCAACCGCGTCGTTTCCCTCCGCCTCCCCGGCGCCGGACTCTCCGGGCAAATCCCACTAAACAC...

CDS

Download CDS FASTA

1824 bp · LXL04_021183|LXL04_021183|OH1004|CDS

ATGGAAACCCTTAATCTTCTTGCAATAATATTCCTCTGTGTTCTCTGTTTCCAATCGGAAGTTTCCTTTTCCAACATCGACGCCGACAGAGACGCACTCATCAGATTCAGCTCCGCCGTAAATGGCAACACAATCCAGTGGAACATTTCCAACCCATCACCGTGTTCATGGAAAGGAGTCACATGCAGCACCACGATCAACCGCGTCGTTTCCCTCCGCCTCCCCGGCGCCGGACTCTCCGGGCAAATCCCACTAAACAC...

Protein

Download Protein FASTA

607 aa · LXL04_021183|LXL04_021183|OH1004|PROTEIN

METLNLLAIIFLCVLCFQSEVSFSNIDADRDALIRFSSAVNGNTIQWNISNPSPCSWKGVTCSTTINRVVSLRLPGAGLSGQIPLNTIGNLTRLRTLSLRGNLLSGEVPQDLEFCSELRILNLQNNRLSGEIPVTLFRLSNLTRLDISGNNFSGEISPSFSNLTRLTHLLLENNRFTGQIPEINTPFSQFNVSMNRLTGRIPTRLATFPSNAFTGNELCGTPLSSCPNGDKSNKLSAGAIAGIAIGSVLGSILIIAVVLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021183`
TK1151 ID	TkA05G362060
OH-1004 ID	LXL04_021183
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021183

Location Chr04:123580318-123582254 (+)

Description Similar to RKL1: Probable inactive receptor kinase At1g48480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48480`	Probable inactive receptor kinase At1g48480.	No verified direct reference in this release
`At3g17840`	Probable inactive receptor kinase RLK902.	No verified direct reference in this release
`At3g02880`	Probable inactive receptor kinase At3g02880.	No verified direct reference in this release
`At5g16590`	Might be involved in early recognition of growth promoting fungi.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0022898 regulation of transmembrane transporter activity Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G48480

ath:AT2G26730

ath:AT3G02880

ath:AT3G17840

ath:AT5G16590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884

Rank 1 · LXL04_021183 · OH-1004

Endoplasmic reticulum0.074

Rank 2 · LXL04_021183 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_021183 · OH-1004

Nucleus0.053

Rank 4 · LXL04_021183 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_021183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_227-63 aa

PF23598.2LRR_1472-171 aa

PF13855.13LRR_886-128 aa

PF12799.14LRR_492-129 aa

PF12799.14LRR_4117-158 aa

PF13855.13LRR_8117-176 aa

PF12799.14LRR_4141-176 aa

PF07714.24PK_Tyr_Ser-Thr341-600 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021183	`PF08263.18`	LRRNT_2	27	63	5.4e-10	40.1
LXL04_021183	`PF23598.2`	LRR_14	72	171	9.7e-08	31.9
LXL04_021183	`PF13855.13`	LRR_8	86	128	8.4e-10	39.0
LXL04_021183	`PF12799.14`	LRR_4	92	129	5.6e-10	39.9
LXL04_021183	`PF12799.14`	LRR_4	117	158	5.6e-10	39.9
LXL04_021183	`PF13855.13`	LRR_8	117	176	8.4e-10	39.0
LXL04_021183	`PF12799.14`	LRR_4	141	176	5.6e-10	39.9
LXL04_021183	`PF07714.24`	PK_Tyr_Ser-Thr	341	600	5.6e-29	102.0
LXL04_021183	`PF00069.32`	Pkinase	341	532	7.4e-25	88.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LP77`	Arabidopsis thaliana	Probable inactive receptor kinase At1g48480	46.440%	Swiss-Prot	moderate database homology
`Q9LVI6`	Arabidopsis thaliana	Probable inactive receptor kinase RLK902	46.719%	Swiss-Prot	moderate database homology
`Q9M8T0`	Arabidopsis thaliana	Probable inactive receptor kinase At3g02880	45.353%	Swiss-Prot	moderate database homology
`Q9FMD7`	Arabidopsis thaliana	Probable inactive receptor kinase At5g16590	44.480%	Swiss-Prot	moderate database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	43.471%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card