LXL04_021163 | RubberDandelionOmics

Gene overview

LXL04_021163

Reference: OH-1004 Chr: Chr04 Coordinates: 122943878-122948570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2265 bp · LXL04_021163|LXL04_021163|OH1004|cDNA

ATGGACTTTTCTCCGGCTGCTCGCCGATCGAGCAGAAAGCCGACAAAGTCAGAGCTCTACTCAACGTTTGTAGTTCATAGCGACGAGGAAGACGACGATGCCCAAACCCAAAAGAACCCTAAAAAGGCAGATGCAGGAGATATATACGCTACAATGCTATGTAAAGAAGATGACGATCCAAACGACGACGAATCACTACCTCCTCTCCTCAAGCGCCTGCCGAAAGACTTCGGAGTCGATGTAGATTCCGACGACGATGG...

CDS

Download CDS FASTA

2265 bp · LXL04_021163|LXL04_021163|OH1004|CDS

ATGGACTTTTCTCCGGCTGCTCGCCGATCGAGCAGAAAGCCGACAAAGTCAGAGCTCTACTCAACGTTTGTAGTTCATAGCGACGAGGAAGACGACGATGCCCAAACCCAAAAGAACCCTAAAAAGGCAGATGCAGGAGATATATACGCTACAATGCTATGTAAAGAAGATGACGATCCAAACGACGACGAATCACTACCTCCTCTCCTCAAGCGCCTGCCGAAAGACTTCGGAGTCGATGTAGATTCCGACGACGATGG...

Protein

Download Protein FASTA

754 aa · LXL04_021163|LXL04_021163|OH1004|PROTEIN

MDFSPAARRSSRKPTKSELYSTFVVHSDEEDDDAQTQKNPKKADAGDIYATMLCKEDDDPNDDESLPPLLKRLPKDFGVDVDSDDDGESISGTMIVKTGRRRVQSSYRRDESDEEEDEDEEGGDFGTFVVRSEGRENESVSGTFVRRTSGGTGGMSTMSRAVASMQSAGEGFGRPRKGTGTPTSSSQDEEGAHSRQPRSKMSSGSIADSVTREDPSTKYELLHELGKGSYGSVYKARDLKTSEMVAIKVISLSEGEEGYE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021163`
TK1151 ID	TkA05G358970
OH-1004 ID	LXL04_021163
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021163

Location Chr04:122943878-122948570 (+)

Description Similar to dst1: Serine/threonine-protein kinase dst1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69220`	Serine/threonine-protein kinase.	The Hippo/STE20 homolog SIK1 interacts with MOB1 to regulate cell proliferation and cell expansion in Arabidopsis.2016 · DOI: 10.1093/jxb/erv538 The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021163 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0012501 programmed cell death Biological Process

GO:0035329 hippo signaling Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043408 regulation of MAPK cascade Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G69220

ddi:DDB_G0274593

ddi:DDB_G0284181

xla:398925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.654

Rank 1 · LXL04_021163 · OH-1004

Nucleus0.268

Rank 2 · LXL04_021163 · OH-1004

Cell membrane0.222

Rank 3 · LXL04_021163 · OH-1004

Golgi apparatus0.101

Rank 4 · LXL04_021163 · OH-1004

Lysosome / Vacuole0.062

Rank 5 · LXL04_021163 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase219-473 aa

PF07714.24PK_Tyr_Ser-Thr221-469 aa

PF03109.23ABC1291-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021163	`PF00069.32`	Pkinase	219	473	2e-70	237.9
LXL04_021163	`PF07714.24`	PK_Tyr_Ser-Thr	221	469	2.9e-51	175.0
LXL04_021163	`PF03109.23`	ABC1	291	370	3.7e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24527`	Arabidopsis thaliana	Serine/threonine-protein kinase 1	59.717%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card