LXL04_021158 | RubberDandelionOmics

Gene overview

LXL04_021158

Reference: OH-1004 Chr: Chr04 Coordinates: 122884915-122888292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1512 bp · LXL04_021158|LXL04_021158|OH1004|cDNA

ATGAAGCCTTGGTTGACTCAAGGATCGTCTCTTCTCCAATTTGACGACCGTGGTTCATTTCTCGAGAATCAAACTTTCGTCTCCAAAGAATCAGGATCCCGTAAAACGACTGATACGCGAGTAAAATTCCGCCGACTAGAAGTCGATCATTCGGCGGCTATGGGAGAAGAAATTGACAAGTTGAAATCTCAACTTGTAATTGAAGAATGGAGCGGGACTTCTTCGAACAAACTCTCGTTGACGGCCGTTATATCGCCGTC...

CDS

Download CDS FASTA

1512 bp · LXL04_021158|LXL04_021158|OH1004|CDS

ATGAAGCCTTGGTTGACTCAAGGATCGTCTCTTCTCCAATTTGACGACCGTGGTTCATTTCTCGAGAATCAAACTTTCGTCTCCAAAGAATCAGGATCCCGTAAAACGACTGATACGCGAGTAAAATTCCGCCGACTAGAAGTCGATCATTCGGCGGCTATGGGAGAAGAAATTGACAAGTTGAAATCTCAACTTGTAATTGAAGAATGGAGCGGGACTTCTTCGAACAAACTCTCGTTGACGGCCGTTATATCGCCGTC...

Protein

Download Protein FASTA

503 aa · LXL04_021158|LXL04_021158|OH1004|PROTEIN

MKPWLTQGSSLLQFDDRGSFLENQTFVSKESGSRKTTDTRVKFRRLEVDHSAAMGEEIDKLKSQLVIEEWSGTSSNKLSLTAVISPSTSPSSFTLKIHGNRFNLFSRRFLEAFVPEGFPSSVTPDYIPFQTWDLLQGLSTYIRTMLSTQALLSAIGVGEKSATVIGATFQWFLRDLTGMLGGVMFTFYQGSNLDSNAKMWRLVADLMNDLGMLMDLVSPLFPSAFIFIVCIGSLSRSFTGVASGATRAALTQHFALQNNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021158`
TK1151 ID	TkA05G358630
OH-1004 ID	LXL04_021158
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 89.463 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021158

Location Chr04:122884915-122888292 (-)

Description Similar to RUS3: Protein root UVB sensitive 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13770`	Protein root UVB sensitive 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021158 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G13770

hsa:64755

mmu:233913

pon:100173090

rno:361654

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.242

Rank 1 · LXL04_021158 · OH-1004

Endoplasmic reticulum0.233

Rank 2 · LXL04_021158 · OH-1004

Golgi apparatus0.111

Rank 3 · LXL04_021158 · OH-1004

Mitochondrion0.110

Rank 4 · LXL04_021158 · OH-1004

Peroxisome0.107

Rank 5 · LXL04_021158 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04884.21UVB_sens_prot105-347 aa

PF24160.2UVB_sens_C350-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021158	`PF04884.21`	UVB_sens_prot	105	347	1.1e-87	294.4
LXL04_021158	`PF24160.2`	UVB_sens_C	350	497	8.4e-10	39.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JB8`	Arabidopsis thaliana	Protein root UVB sensitive 3	65.169%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card