LXL04_021153 | RubberDandelionOmics

Gene overview

LXL04_021153

Reference: OH-1004 Chr: Chr04 Coordinates: 122818534-122821141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · LXL04_021153|LXL04_021153|OH1004|cDNA

ATGGCTGCTTTTGCACTTTCCATGGTGGTTCTCTTAGCCATGGCGGACTATTCAAGCGCAGCTTATTGTGTATGTAACTCTGGTCTAAGCGACTCAGTTCTTCAAAAGAACATAGATTATGCTTGCGGAAATGGAGCCGATTGTACTCTAATCATTCAAGGCGGTGCTTGTTTTAGCCCCAATACTGTCAAAGATCACTGTAATTACGCCGTCAACAGTTATTTTCAAAGAAAGGGTGAAGTTTCAGGGAGCTGTGTCTT...

CDS

Download CDS FASTA

627 bp · LXL04_021153|LXL04_021153|OH1004|CDS

ATGGCTGCTTTTGCACTTTCCATGGTGGTTCTCTTAGCCATGGCGGACTATTCAAGCGCAGCTTATTGTGTATGTAACTCTGGTCTAAGCGACTCAGTTCTTCAAAAGAACATAGATTATGCTTGCGGAAATGGAGCCGATTGTACTCTAATCATTCAAGGCGGTGCTTGTTTTAGCCCCAATACTGTCAAAGATCACTGTAATTACGCCGTCAACAGTTATTTTCAAAGAAAGGGTGAAGTTTCAGGGAGCTGTGTCTT...

Protein

Download Protein FASTA

208 aa · LXL04_021153|LXL04_021153|OH1004|PROTEIN

MAAFALSMVVLLAMADYSSAAYCVCNSGLSDSVLQKNIDYACGNGADCTLIIQGGACFSPNTVKDHCNYAVNSYFQRKGEVSGSCVFSNTATVSPTAPPGATSTCYAGSSSSSTPTTPSTPGTGTGTGTPGTGTGTGTGTPGTGTGTGTGTGTPGTSFGTGGTGTSTGMTPTFGLGPTATDNSGAESSDCLTLLTLLVPGLILWWRLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021153`
TK1151 ID	TkA05G358150
OH-1004 ID	LXL04_021153
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 99.526 / OH-1004 99.038 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021153

Location Chr04:122818534-122821141 (+)

Description Similar to PDCB3: PLASMODESMATA CALLOSE-BINDING PROTEIN 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18650`	PLASMODESMATA CALLOSE-BINDING PROTEIN 3.	No verified direct reference in this release
`At5g61130`	Able to bind (1->3)-beta-D-glucans (laminarin).	An Arabidopsis GPI-anchor plasmodesmal neck protein with callose binding activity and potential to regulate cell-to-cell trafficking.2009 · DOI: 10.1105/tpc.108.060145
`At5g08000`	Able to bind (1->3)-beta-D-glucans (laminarin).	An Arabidopsis GPI-anchor plasmodesmal neck protein with callose binding activity and potential to regulate cell-to-cell trafficking.2009 · DOI: 10.1105/tpc.108.060145
`At1g69295`	PLASMODESMATA CALLOSE-BINDING PROTEIN 4.	No verified direct reference in this release
`At1g26450`	Carbohydrate-binding X8 domain-containing protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021153 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0052543 callose deposition in cell wall Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0001872 (1->3)-beta-D-glucan binding Molecular Function

KEGG gene cross-reference

ath:AT1G18650

ath:AT1G26450

ath:AT1G69295

ath:AT5G08000

ath:AT5G61130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.770

Rank 1 · LXL04_021153 · OH-1004

Extracellular0.094

Rank 2 · LXL04_021153 · OH-1004

Cytoplasm0.087

Rank 3 · LXL04_021153 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_021153 · OH-1004

Nucleus0.045

Rank 5 · LXL04_021153 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07983.19X822-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021153	`PF07983.19`	X8	22	92	6e-19	69.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ86`	Arabidopsis thaliana	PLASMODESMATA CALLOSE-BINDING PROTEIN 3	50.000%	Swiss-Prot	strong database homology
`Q9FNQ2`	Arabidopsis thaliana	PLASMODESMATA CALLOSE-BINDING PROTEIN 1	49.254%	Swiss-Prot	moderate database homology
`Q9SD84`	Arabidopsis thaliana	PLASMODESMATA CALLOSE-BINDING PROTEIN 2	45.399%	Swiss-Prot	moderate database homology
`Q93V72`	Arabidopsis thaliana	PLASMODESMATA CALLOSE-BINDING PROTEIN 4	53.000%	Swiss-Prot	weak database homology
`Q9FZD0`	Arabidopsis thaliana	Carbohydrate-binding X8 domain-containing protein	47.253%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card