LXL04_021066 | RubberDandelionOmics

Gene overview

LXL04_021066

Reference: OH-1004 Chr: Chr04 Coordinates: 120455947-120456950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · LXL04_021066|LXL04_021066|OH1004|cDNA

ATGGTGATAAGGGAAAAAAACTGTAATCTCCCGCCGGGTTTTCGATTTCACCCCACCGATGAAGAATTGATAATGTTTTATCTGCGAAACCAGTCGTTATCTAAGCCATGCCCTGTTTCTATAATCCCCGAGGTTGATATTTACAAATTTGATCCATGGGAGTTGCCTGAGAAAACAGAATTCGAAGAAAACGAATGGTATTTCTTCACCCCTCGCGATAGAAAGTACCCAAATGGAGTTCGTCCAAATCGGGCAGCTGT...

CDS

Download CDS FASTA

840 bp · LXL04_021066|LXL04_021066|OH1004|CDS

ATGGTGATAAGGGAAAAAAACTGTAATCTCCCGCCGGGTTTTCGATTTCACCCCACCGATGAAGAATTGATAATGTTTTATCTGCGAAACCAGTCGTTATCTAAGCCATGCCCTGTTTCTATAATCCCCGAGGTTGATATTTACAAATTTGATCCATGGGAGTTGCCTGAGAAAACAGAATTCGAAGAAAACGAATGGTATTTCTTCACCCCTCGCGATAGAAAGTACCCAAATGGAGTTCGTCCAAATCGGGCAGCTGT...

Protein

Download Protein FASTA

279 aa · LXL04_021066|LXL04_021066|OH1004|PROTEIN

MVIREKNCNLPPGFRFHPTDEELIMFYLRNQSLSKPCPVSIIPEVDIYKFDPWELPEKTEFEENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGKPPKGIKTDWIMHEYRLKESRSQPAKKLGSMRLDDWVLCRIYKKKTAAKPLDQIEEDINSQNVPNDEHNSMGLQSMKIPRSFSLAHLWELESLGSISHLLDDHHNTNYENNAGIETRGTVDIMPQSSTPFLETRLRESHSVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021066`
TK1151 ID	TkA05G349440
OH-1004 ID	LXL04_021066
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021066

Location Chr04:120455947-120456950 (-)

Description Similar to NAP2: NAC domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69490`	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3.	No verified direct reference in this release
`At1g61110`	Transcription factor of the NAC family.	A cis regulatory element in the TAPNAC promoter directs tapetal gene expression.2011 · DOI: 10.1007/s11103-010-9713-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0327800`	Transcription factor that acts as a positive regulator of the jasmonate (JA) pathway to mediate leaf senescence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021066 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009908 flower development Biological Process

GO:0010150 leaf senescence Biological Process

KEGG gene cross-reference

ath:AT1G61110

ath:AT1G69490

dosa:Os03g0327800

osa:4332717

sly:101244582

sly:101248665

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_021066 · OH-1004

Cytoplasm0.103

Rank 2 · LXL04_021066 · OH-1004

Cell membrane0.036

Rank 3 · LXL04_021066 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_021066 · OH-1004

Plastid0.014

Rank 5 · LXL04_021066 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM11-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021066	`PF02365.21`	NAM	11	135	6.4e-51	172.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49255`	Arabidopsis thaliana	NAC transcription factor 29	69.683%	Swiss-Prot	strong database homology
`Q8GY42`	Arabidopsis thaliana	NAC transcription factor 25	68.639%	Swiss-Prot	moderate database homology
`Q8H7M1`	Oryza sativa subsp. japonica	NAC domain-containing protein 58	68.605%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card