LXL04_021056 | RubberDandelionOmics

Gene overview

LXL04_021056

Reference: OH-1004 Chr: Chr04 Coordinates: 120151747-120153942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · LXL04_021056|LXL04_021056|OH1004|cDNA

ATGGGTTCAGAATCAGAGGTACCAGTGTCCCTTTTGATCGAGAGACTCATGGCGATGCCCTTCTTCTCAGGCTTCACACCCACCAGACCCGAATCGGATTCGAGCAACGATTCCGAACATCCGGATCATGAATCTACAAACAGTCATCATCCGGGTTCGTCACCTGATCGGATCATCCTGATCAACCCGATGACGCAAGGAATGGTGGTGATCAGAGGTAGCTCGACGGGTTTCGATTCCCTGATGAACGATCTGATGAG...

CDS

Download CDS FASTA

1026 bp · LXL04_021056|LXL04_021056|OH1004|CDS

ATGGGTTCAGAATCAGAGGTACCAGTGTCCCTTTTGATCGAGAGACTCATGGCGATGCCCTTCTTCTCAGGCTTCACACCCACCAGACCCGAATCGGATTCGAGCAACGATTCCGAACATCCGGATCATGAATCTACAAACAGTCATCATCCGGGTTCGTCACCTGATCGGATCATCCTGATCAACCCGATGACGCAAGGAATGGTGGTGATCAGAGGTAGCTCGACGGGTTTCGATTCCCTGATGAACGATCTGATGAG...

Protein

Download Protein FASTA

341 aa · LXL04_021056|LXL04_021056|OH1004|PROTEIN

MGSESEVPVSLLIERLMAMPFFSGFTPTRPESDSSNDSEHPDHESTNSHHPGSSPDRIILINPMTQGMVVIRGSSTGFDSLMNDLMRKDGQPPASQTSIDTMPSVEIKGTDELECLEGECVICLEEWGVGDVVKEMPCKHKFHGGCVEKWLKIHGSCPVCRHQMPVDCSDKKTGDEGVRGRREIWVTFSFADGRSTSEGSVESNQESTKEPFNNSFTLVSHPNVLIFQRRKFADLQLPTAKIKQRGGVTVVNFQVFNKAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021056`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021056

Location Chr04:120151747-120153942 (+)

Description Similar to MPSR1: E3 ubiquitin-protein ligase MPSR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26800`	E3 ubiquitin-protein ligase involved in protein quality control (PQC) under proteotoxic stress.	MPSR1 is a cytoplasmic PQC E3 ligase for eliminating emergent misfolded proteins in Arabidopsis thaliana.2017 · DOI: 10.1073/pnas.1713574114
`At3g19950`	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.	No verified direct reference in this release
`At3g46620`	E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid-dependent drought stress responses.	Suppression of Arabidopsis RING-DUF1117 E3 ubiquitin ligases, AtRDUF1 and AtRDUF2, reduces tolerance to ABA-mediated drought stress.2012 · DOI: 10.1016/j.bbrc.2012.02.131 The E3 ligase AtRDUF1 positively regulates salt stress responses in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071078
`At5g20910`	E3 ubiquitin-protein ligase that acts as a negative regulator of abscisic acid (ABA) signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021056 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0061635 regulation of protein complex stability Biological Process

GO:0071218 cellular response to misfolded protein Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071629 cytoplasm protein quality control by the ubiquitin-proteasome system Biological Process

KEGG gene cross-reference

ath:AT1G26800

ath:AT3G19950

ath:AT3G46620

ath:AT5G20910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · LXL04_021056 · OH-1004

Nucleus0.447

Rank 2 · LXL04_021056 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_021056 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_021056 · OH-1004

Mitochondrion0.080

Rank 5 · LXL04_021056 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2119-161 aa

PF17123.12zf-RING_11119-147 aa

PF13923.13zf-C3HC4_2119-160 aa

PF12678.14zf-rbx1119-161 aa

PF00097.32zf-C3HC4120-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021056	`PF13639.13`	zf-RING_2	119	161	1.1e-15	58.3
LXL04_021056	`PF17123.12`	zf-RING_11	119	147	5.3e-09	36.3
LXL04_021056	`PF13923.13`	zf-C3HC4_2	119	160	6.7e-08	32.9
LXL04_021056	`PF12678.14`	zf-rbx1	119	161	3.3e-06	28.0
LXL04_021056	`PF00097.32`	zf-C3HC4	120	160	9.5e-07	29.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQX2`	Arabidopsis thaliana	E3 ubiquitin-protein ligase MPSR1	49.495%	Swiss-Prot	moderate database homology
`Q8LPN7`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RING1-like	41.000%	Swiss-Prot	weak database homology
`Q9SNB6`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RDUF1	37.815%	Swiss-Prot	weak database homology
`Q8RXD3`	Arabidopsis thaliana	E3 ubiquitin-protein ligase AIP2	40.206%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card